Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 α, MAP1LC3A (C-6His)

Contact us
Catalog number: CE88
Price: 1431 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 α, MAP1LC3A (C-6His)
Quantity: 1000ug
Other quantities: 1 mg 2283€ 10 µg 146€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human MAP1LC3A is produced by our E, coli expression system and the target gene encoding Met1-Phe121 is expressed with a 6His tag at the C-terminus
Molecular Weight: 15, 3 kD
UniProt number: Q9H492
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 0, 20% Glycerol, pH 8, 1M sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGFLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: MAP1LC3A (C-6His), Microtubule-Associated Protein 1 Light Chain 3 &alpha
Short name: MAP1LC3A (C-6His), Recombinant Microtubule-Associated Protein 1 Light Chain 3 &alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: MAP1LC3A (C-6His), sapiens Microtubule-Associated Protein 1 Light epitope 3 &alpha, recombinant H
Alternative technique: rec
Identity: 6838
Gene: MAP1LC3A | More about : MAP1LC3A
Long gene name: microtubule associated protein 1 light chain 3 alpha
Synonyms: MAP1BLC3 MAP1ALC3 LC3 LC3A ATG8E
Locus: 20q11, 22
Discovery year: 2000-06-29
Entrez gene record: 84557
Pubmed identfication: 8833088 17580304
RefSeq identity: NM_181509
Classification: Autophagy related
Havana BLAST/BLAT: OTTHUMG00000032306

Related Products :

CE88 Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 α, MAP1LC3A (C-6His) 500 µg 1613 € novo human
MBS611747 MAP1LC3A, NT (Microtubule Associated Protein 1 Light Chain 3 alpha, MAP1 Light Chain 3A, APG8, Autophagy Related Protein LC3A, Autophagy Related Ubiquitin-like Modifier LC3A, LC3A, MAP1 Light Chain 3 Like Protein 1, Microtubule Associated Proteins 1A/1B L Antibody 100ul 652 € MBS Polyclonals_1 human
DL-MAP1LC3a-Hu Human Microtubule Associated Protein 1 Light Chain 3 Alpha MAP1LC3a ELISA Kit 96T 974 € DL elisas human
EKU05948 Microtubule Associated Protein 1 Light Chain 3 Alpha (MAP1LC3a) ELISA kit 1 plate of 96 wells 899 € Biomatik ELISA kits human
EKU05949 Microtubule Associated Protein 1 Light Chain 3 Alpha (MAP1LC3a) ELISA kit 1 plate of 96 wells 972 € Biomatik ELISA kits human
MBS620920 TPX2 (Targeting Protein for XKLP2, TPX2 Microtubule-associated Homolog, TPX2 Microtubule-associated Protein Homolog, C20orf2, Chromosome 20 Open Reading Frame 1, C20ORF1, Differentially Expressed in Cancerous and Noncancerous Lung Cells 2, Differentially 100ul 608 € MBS Polyclonals_1 human
abx261988 Anti-Microtubule-Associated Protein 1 Light Chain 3 alpha Protein (Recombinant) 5 µg 238 € abbex human
CG98 Recombinant Human Microtubule-associated Proteins 1A, 1B Light Chain 3B, MAP1LC3B 500 µg 1328 € novo human
abx261373 Anti-Microtubule-Associated Protein 1 Light Chain 3 beta 2 Protein (Recombinant) 20 µg 340 € abbex human
abx260841 Anti-Microtubule-Associated Protein 1 Light Chain 3 beta Protein (Recombinant) 1 mg 3559 € abbex human
C177 Recombinant Human Microtubule-Associated Protein Tau, MAPT-D, Tau-D (C-6His) 10 µg 156 € novo human
abx251588 Anti-Human Microtubule-associated proteins 1A/1B light chain 3A ELISA Kit inquire 50 € abbex human
abx251589 Anti-Human Microtubule-associated proteins 1A/1B light chain 3B ELISA Kit inquire 50 € abbex human
GENTAUR-58ba5a40b3c18 Human Microtubule-associated proteins 1A/1B light chain 3 beta 2 (MAP1LC3B2) 100ug 1415 € MBS Recombinant Proteins human
GENTAUR-58ba5a43241ec Human Microtubule-associated proteins 1A/1B light chain 3 beta 2 (MAP1LC3B2) 1000ug 1415 € MBS Recombinant Proteins human
GENTAUR-58ba5a43a51d7 Human Microtubule-associated proteins 1A/1B light chain 3 beta 2 (MAP1LC3B2) 100ug 1923 € MBS Recombinant Proteins human
GENTAUR-58ba5a4475536 Human Microtubule-associated proteins 1A/1B light chain 3 beta 2 (MAP1LC3B2) 1000ug 1923 € MBS Recombinant Proteins human
GENTAUR-58bd917d98fdd Human Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 100ug 1415 € MBS Recombinant Proteins human
GENTAUR-58bd917df0a56 Human Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 1000ug 1415 € MBS Recombinant Proteins human
GENTAUR-58bd917e745f3 Human Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 100ug 1923 € MBS Recombinant Proteins human
GENTAUR-58bd917edd54c Human Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 1000ug 1923 € MBS Recombinant Proteins human
MBS613995 MAP1LC3B (LC3B, Autophagy Related Protein LC3B, Autophagy Related Ubiquitin-like Modifier LC3B, MAP1 Light Chain 3-like Protein 2, Microtubule Associated Proteins 1A/1B Light Chain 3B, MAP1A/1B Light Chain 3B, MAP1A/MAP1B LC3B, Microtubule Associated Prot Antibody 100ul 636 € MBS Polyclonals_1 human
MBS616757 MAP1LC3C (Microtubule Associated Proteins 1A/1B Light Chain 3C, Autophagy Related Protein LC3C, Autophagy Related Ubiquitin-like Modifier LC3C, LC3C, LC3-like Protein 2, MAP1 Light Chain 3-like Protein 2, MAP1 Light Chain 3-like Protein 3, MAP1A/MAP1BLC3C Antibody 100ul 652 € MBS Polyclonals_1 human
abx255115 Anti-Mouse Microtubule-associated proteins 1A/1B light chain 3B ELISA Kit 96 tests 659 € abbex mouse
GENTAUR-58b9a7cdd2118 Bovine Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 100ug 1431 € MBS Recombinant Proteins bovine
GENTAUR-58b9a7ce4fac2 Bovine Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 1000ug 1431 € MBS Recombinant Proteins bovine
GENTAUR-58b9a7ceafa2e Bovine Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 100ug 1934 € MBS Recombinant Proteins bovine
GENTAUR-58b9a7cf26cc7 Bovine Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 1000ug 1934 € MBS Recombinant Proteins bovine
GENTAUR-58ba22a9a9163 Bovine Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 100ug 1431 € MBS Recombinant Proteins bovine
GENTAUR-58ba22aa57d66 Bovine Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 1000ug 1431 € MBS Recombinant Proteins bovine