| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human 14-3-3 Protein epsilon is produced by our E, coli expression system and the target gene encoding Met1-Gln255 is expressed with a GST tag at the N-terminus |
| Molecular Weight: |
56 kD |
| UniProt number: |
P62258 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
YWHAE (N-GST), 14-3-3 Protein &epsilon |
| Short name: |
YWHAE (N-GST), Recombinant 14-3-3 Protein &epsilon |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
epsilon polypeptide (N-GST), sapiens 14-3-3 Protein &epsilon, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
14-3-3E and HEL2 and KCIP-1 and MDCR and MDS, Plasma membranes, YWHAE and IDBG-14629 and ENSG00000108953 and 7531, YWHAE and IDBG-632682 and ENSBTAG00000005664 and 282125, Ywhae and IDBG-200597 and ENSMUSG00000020849 and 22627, epsilon polypeptide, phosphoprotein binding, this GO :0000086 and G2/M transition of mitotic cell cycle and biological process this GO :0000278 and mitotic cell cycle and biological process this GO :0001764 and neuron migration and biological process this GO :0003064 and regulation of heart rate by hormone and biological process this GO :0005515 and protein binding and molecular function this GO :0005739 and mitochondrion and cellular component this GO :0005829 and cytosol and cellular component this GO :0005871 and kinesin complex and cellular component this GO :0006605 and protein targeting and biological process this GO :0006915 and apoptotic process and biological process this GO :0015459 and potassium channel regulator activity and molecular function this GO :0016020 and membrane and cellular component this GO :0016032 and viral process and biological process this GO :0019899 and enzyme binding and molecular function this GO :0019904 and protein domain specific binding and molecular function this GO :0021762 and substantia nigra development and biological process this GO :0021766 and hippocampus development and biological process this GO :0021987 and cerebral cortex development and biological process this GO :0023026 and MHC class II protein complex binding and molecular function this GO :0030424 and axon and cellular component this GO :0030659 and cytoplasmic vesicle membrane and cellular component this GO :0032403 and protein complex binding and molecular function this GO :0035308 and negative regulation of protein dephosphorylation and biological process this GO :0035329 and hippo signaling and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0042470 and melanosome and cellular component this GO :0042826 and histone deacetylase binding and molecular function this GO :0043281 and regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0044325 and ion channel binding and molecular function this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0050815 and phosphoserine binding and molecular function this GO :0051219 and phosphoprotein binding and molecular function this GO :0060306 and regulation of membrane repolarization and biological process this GO :0061024 and membrane organization and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0086013 and membrane repolarization during cardiac muscle cell action potential and biological process this GO :0086091 and regulation of heart rate by cardiac conduction and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :0097193 and intrinsic apoptotic signaling pathway and biological process this GO :1900740 and positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway and biological process this GO :1901016 and regulation of potassium ion transmembrane transporter activity and biological process this GO :1902309 and negative regulation of peptidyl-serine dephosphorylation and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0015459 : potassium channel regulator activity and also this GO :0019899 : enzyme binding and also this GO :0019904 : protein domain specific binding and also this GO :0023026 : MHC class II protein complex binding and also this GO :0032403 : protein complex binding and also this GO :0042826 : histone deacetylase binding and also this GO :0044325 : ion channel binding and also this GO :0044822 : poly(A) RNA binding and also this GO :0046982 : protein heterodimerization activity and also this GO :0050815 : phosphoserine binding and also this GO :0051219 : phosphoprotein binding, this GO :0015459 : potassium channel regulator activity, this GO :0019899 : enzyme binding, this GO :0019904 : protein domain specific binding, this GO :0023026 : MHC class II protein complex binding, this GO :0032403 : protein complex binding, this GO :0042826 : histone deacetylase binding, this GO :0044325 : ion channel binding, this GO :0044822 : poly(A) RNA binding, this GO :0046982 : protein heterodimerization activity, this GO :0050815 : phosphoserine binding, this GO :0051219 : phosphoprotein binding, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein |
| Identity: |
12854 |
| Gene: |
YWHAQ |
More about : YWHAQ |
| Long gene name: |
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta |
| Synonyms gene name: |
theta , theta polypeptide protein, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein |
| Synonyms: |
HS1 14-3-3 |
| Synonyms name: |
protein tau |
| Locus: |
2p25, 1 |
| Discovery year: |
1999-08-20 |
| GenBank acession: |
AF070556 |
| Entrez gene record: |
10971 |
| Pubmed identfication: |
11080204 |
| RefSeq identity: |
NM_006826 |
| Classification: |
14-3-3 phospho-serine/phospho-threonine binding proteins |
| Havana BLAST/BLAT: |
OTTHUMG00000013848 |