Recombinant Human 14-3-3 Protein ε, YWHAE (N-GST)

Contact us
Catalog number: CE07
Price: 481 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human 14-3-3 Protein ε, YWHAE (N-GST)
Quantity: 50ug
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human 14-3-3 Protein epsilon is produced by our E, coli expression system and the target gene encoding Met1-Gln255 is expressed with a GST tag at the N-terminus
Molecular Weight: 56 kD
UniProt number: P62258
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: YWHAE (N-GST), 14-3-3 Protein &epsilon
Short name: YWHAE (N-GST), Recombinant 14-3-3 Protein &epsilon
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: epsilon polypeptide (N-GST), sapiens 14-3-3 Protein &epsilon, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, recombinant H
Alternative technique: rec
Alternative to gene target: 14-3-3E and HEL2 and KCIP-1 and MDCR and MDS, Plasma membranes, YWHAE and IDBG-14629 and ENSG00000108953 and 7531, YWHAE and IDBG-632682 and ENSBTAG00000005664 and 282125, Ywhae and IDBG-200597 and ENSMUSG00000020849 and 22627, epsilon polypeptide, phosphoprotein binding, this GO :0000086 and G2/M transition of mitotic cell cycle and biological process this GO :0000278 and mitotic cell cycle and biological process this GO :0001764 and neuron migration and biological process this GO :0003064 and regulation of heart rate by hormone and biological process this GO :0005515 and protein binding and molecular function this GO :0005739 and mitochondrion and cellular component this GO :0005829 and cytosol and cellular component this GO :0005871 and kinesin complex and cellular component this GO :0006605 and protein targeting and biological process this GO :0006915 and apoptotic process and biological process this GO :0015459 and potassium channel regulator activity and molecular function this GO :0016020 and membrane and cellular component this GO :0016032 and viral process and biological process this GO :0019899 and enzyme binding and molecular function this GO :0019904 and protein domain specific binding and molecular function this GO :0021762 and substantia nigra development and biological process this GO :0021766 and hippocampus development and biological process this GO :0021987 and cerebral cortex development and biological process this GO :0023026 and MHC class II protein complex binding and molecular function this GO :0030424 and axon and cellular component this GO :0030659 and cytoplasmic vesicle membrane and cellular component this GO :0032403 and protein complex binding and molecular function this GO :0035308 and negative regulation of protein dephosphorylation and biological process this GO :0035329 and hippo signaling and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0042470 and melanosome and cellular component this GO :0042826 and histone deacetylase binding and molecular function this GO :0043281 and regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0044325 and ion channel binding and molecular function this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0050815 and phosphoserine binding and molecular function this GO :0051219 and phosphoprotein binding and molecular function this GO :0060306 and regulation of membrane repolarization and biological process this GO :0061024 and membrane organization and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0086013 and membrane repolarization during cardiac muscle cell action potential and biological process this GO :0086091 and regulation of heart rate by cardiac conduction and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :0097193 and intrinsic apoptotic signaling pathway and biological process this GO :1900740 and positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway and biological process this GO :1901016 and regulation of potassium ion transmembrane transporter activity and biological process this GO :1902309 and negative regulation of peptidyl-serine dephosphorylation and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0015459 : potassium channel regulator activity and also this GO :0019899 : enzyme binding and also this GO :0019904 : protein domain specific binding and also this GO :0023026 : MHC class II protein complex binding and also this GO :0032403 : protein complex binding and also this GO :0042826 : histone deacetylase binding and also this GO :0044325 : ion channel binding and also this GO :0044822 : poly(A) RNA binding and also this GO :0046982 : protein heterodimerization activity and also this GO :0050815 : phosphoserine binding and also this GO :0051219 : phosphoprotein binding, this GO :0015459 : potassium channel regulator activity, this GO :0019899 : enzyme binding, this GO :0019904 : protein domain specific binding, this GO :0023026 : MHC class II protein complex binding, this GO :0032403 : protein complex binding, this GO :0042826 : histone deacetylase binding, this GO :0044325 : ion channel binding, this GO :0044822 : poly(A) RNA binding, this GO :0046982 : protein heterodimerization activity, this GO :0050815 : phosphoserine binding, this GO :0051219 : phosphoprotein binding, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein
Identity: 12854
Gene: YWHAQ | More about : YWHAQ
Long gene name: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta
Synonyms gene name: theta , theta polypeptide protein, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein
Synonyms: HS1 14-3-3
Synonyms name: protein tau
Locus: 2p25, 1
Discovery year: 1999-08-20
GenBank acession: AF070556
Entrez gene record: 10971
Pubmed identfication: 11080204
RefSeq identity: NM_006826
Classification: 14-3-3 phospho-serine/phospho-threonine binding proteins
Havana BLAST/BLAT: OTTHUMG00000013848

Related Products :

MBS621351 Casein Kinase 1 epsilon (Casein Kinase I epsilon, Casein Kinase I Isoform epsilon, CKI epsilon, CKIe, CK1 epsilon, CSNK1E, HCKIE, KC1E, Kinase CK1 epsilon, MGC10398) Antibody 100ug 735 € MBS Polyclonals_1 human
RP-1656H Recombinant Human 14-3-3 epsilon / YWHAE Protein (GST Tag) 20μg 572 € adv human
CE07 Recombinant Human 14-3-3 Protein ε, YWHAE (N-GST) 10 µg 202 € novo human
RP-1602M Recombinant Mouse 14-3-3 epsilon / YWHAE Protein (GST Tag) 20μg 572 € adv mouse
RP-1655H Recombinant Human 14-3-3 epsilon / YWHAE Protein 50μg 624 € adv human
GENTAUR-58bde6365b0f0 Mouse Monoclonal [clone 5A5] (IgG2a,k) to Human YWHAE / 14-3-3 Epsilon Antibody 50ug 597 € MBS mono human
AE10865CH Chicken 14-3-3 protein epsilon (YWHAE) ELISA Kit 48 wells plate 500 € ab-elisa elisas chicken
AE10865CH-96 Chicken 14-3-3 protein epsilon (YWHAE) ELISA Kit 1x plate of 96 wells 671 € abebio chicken
AE10865CH-48 ELISA test for Chicken 14-3-3 protein epsilon (YWHAE) 1x plate of 48 wells 402 € abebio chicken
MBS244175 PAb (IgG) to Sheep YWHAE / 14-3-3 Epsilon 0.05 ml 597 € MBS Polyclonals_1 sheep
GSTA35-R-100 Recombinant purified human GST-alpha 3 (GST A3-3) protein biologically active 100 μg 985 € adi human
GSTA35-R-25 Recombinant purified human GST-alpha 3 (GST A3-3) protein biologically active 25 μg 405 € adi human
GSTA15-R-100 Recombinant purified human GST-alpha (GST-A1) protein biologically active 100 μg 985 € adi human
GSTA15-R-25 Recombinant purified human GST-alpha (GST-A1) protein biologically active 25 μg 405 € adi human
GSTA12-C Recombinant purified human GST-alpha (GST-A1) protein WB +ve control 100 μL 333 € adi human
GSTM25-R-100 Recombinant purified human GST-mu (GST-M1) protein biologically active 100 μg 985 € adi human
GSTM25-R-25 Recombinant purified human GST-mu (GST-M1) protein biologically active 25 μg 405 € adi human
GSTM12-C Recombinant purified human GST-mu (GST-M1) protein WB +ve control 100 μL 333 € adi human
GSTM35-R-25 Recombinant purified human GST-mu (GST-M2) protein 25 μg 405 € adi human
GSTP35-R-100 Recombinant purified human GST-pi (GST-P1) protein biologically active 100 μg 985 € adi human
GSTP35-R-25 Recombinant purified human GST-pi (GST-P1) protein biologically active 25 μg 405 € adi human
GSTP12-C Recombinant purified human GST-pi (GST-P1) protein WB +ve control 100 μL 333 € adi human
GSTT45-R-100 Recombinant purified human GST-T1-1 (GST T1-1) protein biologically active 100 μg 985 € adi human
GSTT45-R-25 Recombinant purified human GST-T1-1 (GST T1-1) protein biologically active 25 μg 405 € adi human
PTEN15-R-10 Recombinant purified Human Phosphatase and tensin homolog (PTEN-GST) fusion Protein (full length, GST-tag) 10 μg 478 € adi human
PTEN15-R-50 Recombinant purified Human Phosphatase and tensin homolog (PTEN-GST) fusion Protein (full length, GST-tag) 50 μg 1058 € adi human
PTEN11-C Recombinant purified Human PTEN-GST fusion Protein (full length, GST-tag) control for WB 100 μL 333 € adi human
AP50115HU-100ug Human YWHAE Protein 0.1mg 184 € abebio human
AP50115HU-1mg Human YWHAE Protein 1mg 604 € abebio human
MBS624161 IKBE, phosphorylated (Ser22) (NFKBIE, NF-kappa-B Inhibitor epsilon, NF-kappa-BIE, I-kappa-B-epsilon, IkB-E, IkB-epsilon, IkappaBepsilon) Antibody 50ug 481 € MBS Polyclonals_1 human