Recombinant Human Fructose-1,6-Bisphosphatase 1, FBPase 1 (C-6His)

Contact us
Catalog number: CD77
Price: 2498 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Fructose-1,6-Bisphosphatase 1, FBPase 1 (C-6His)
Quantity: 100ug
Other quantities: 10 µg 131€ 50 µg 273€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human FBPase 1 is produced by our Mammalian expression system and the target gene encoding Ala2-Gln338 is expressed with a 6His tag at the C-terminus
Molecular Weight: 37, 8 kD
UniProt number: P09467
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 1 mM DTT, 10% Glycerol, 2 um filtered solution of 20 mM TrisHCl, 200 mM sodium chloride, Supplied as a 0, pH 8
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: FBPase 1 (C-6His), 6-Bisphosphatase 1, Fructose-1
Short name: FBPase 1 (C-6His), 6-Bisphosphatase 1, Recombinant Fructose-1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: FBPase 1 (C-6His), sapiens Fructose-1, 6-Bisphosphatase 1, recombinant H
Alternative technique: rec

Related Products :

CD77 Recombinant Human Fructose-1,6-Bisphosphatase 1, FBPase 1 (C-6His) 1 mg 2283 € novo human
C139 Recombinant Human Fructose-1,6-Bisphosphatase 1, FBPase 1 (E. coli, C-6His) 50 µg 273 € novo e-coli
CI45 Recombinant Human Fructose-2,6-Bisphosphatase 1, PFKFB1, PFK, FBPase 1 (C-6His) 10 µg 202 € novo human
GENTAUR-58bb3e484999d Cyanothece sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (cce_3974) 100ug 1989 € MBS Recombinant Proteins human
GENTAUR-58bb3e48978b1 Cyanothece sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (cce_3974) 1000ug 1989 € MBS Recombinant Proteins human
GENTAUR-58bb3e48dae59 Cyanothece sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (cce_3974) 100ug 2498 € MBS Recombinant Proteins human
GENTAUR-58bb3e4923b42 Cyanothece sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (cce_3974) 1000ug 2498 € MBS Recombinant Proteins human
GENTAUR-58bd14a354026 Microcystis aeruginosa D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (MAE_30020) 100ug 1989 € MBS Recombinant Proteins human
GENTAUR-58bd14a39d479 Microcystis aeruginosa D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (MAE_30020) 1000ug 1989 € MBS Recombinant Proteins human
GENTAUR-58bd14a3e7f42 Microcystis aeruginosa D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (MAE_30020) 100ug 2498 € MBS Recombinant Proteins human
GENTAUR-58bd14a42ef2b Microcystis aeruginosa D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (MAE_30020) 1000ug 2498 € MBS Recombinant Proteins human
GENTAUR-58bcf1038cdc1 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (NATL1_08051) 100ug 1956 € MBS Recombinant Proteins human
GENTAUR-58bcf103c8f29 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (NATL1_08051) 1000ug 1956 € MBS Recombinant Proteins human
GENTAUR-58bcf1041ed81 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (NATL1_08051) 100ug 2470 € MBS Recombinant Proteins human
GENTAUR-58bcf1046d45f Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (NATL1_08051) 1000ug 2470 € MBS Recombinant Proteins human
GENTAUR-58b9c280439f2 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (P9301_08271) 100ug 1956 € MBS Recombinant Proteins human
GENTAUR-58b9c28099f77 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (P9301_08271) 1000ug 1956 € MBS Recombinant Proteins human
GENTAUR-58b9c28112857 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (P9301_08271) 100ug 2470 € MBS Recombinant Proteins human
GENTAUR-58b9c28170cc8 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (P9301_08271) 1000ug 2470 € MBS Recombinant Proteins human
GENTAUR-58bb8c0ae4665 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (P9303_16831) 100ug 1956 € MBS Recombinant Proteins human
GENTAUR-58bb8c0b3d188 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (P9303_16831) 1000ug 1956 € MBS Recombinant Proteins human
GENTAUR-58bb8c0b88138 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (P9303_16831) 100ug 2470 € MBS Recombinant Proteins human
GENTAUR-58bb8c0bd7931 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (P9303_16831) 1000ug 2470 € MBS Recombinant Proteins human
GENTAUR-58bd9470e5912 Synechococcus sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (Syncc9902_1229) 100ug 1956 € MBS Recombinant Proteins human
GENTAUR-58bd94714a087 Synechococcus sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (Syncc9902_1229) 1000ug 1956 € MBS Recombinant Proteins human
GENTAUR-58bd9471ae9e2 Synechococcus sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (Syncc9902_1229) 100ug 2470 € MBS Recombinant Proteins human
GENTAUR-58bd9472090ce Synechococcus sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (Syncc9902_1229) 1000ug 2470 € MBS Recombinant Proteins human
GENTAUR-58b9aeb0d8c74 Synechococcus sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (SYNPCC7002_A1301) 100ug 1989 € MBS Recombinant Proteins human
GENTAUR-58b9aeb14ccfc Synechococcus sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (SYNPCC7002_A1301) 1000ug 1989 € MBS Recombinant Proteins human
GENTAUR-58b9aeb1c71b1 Synechococcus sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (SYNPCC7002_A1301) 100ug 2498 € MBS Recombinant Proteins human