Recombinant Human Fructose-1,6-Bisphosphatase 1, FBPase 1 (E. coli, C-6His)

Contact us
Catalog number: C139
Price: 2498 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Fructose-1,6-Bisphosphatase 1, FBPase 1 (E. coli, C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 131€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human FBPase 1 is produced by our E, coli expression system and the target gene encoding Ala2-Gln338 is expressed with a 6His tag at the C-terminus
Molecular Weight: 37, 89 kD
UniProt number: P09467
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 1 mM DTT, 1 mM EDTA, 20% Glycerol, 200 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQVEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: FBPase 1 C-6His), 6-Bisphosphatase 1, Fructose-1
Short name: C-6His), FBPase 1 (E, coli, 6-Bisphosphatase 1, Recombinant Fructose-1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Escherichia coli
Species: E, Humans, coli, coli, E
Alternative name: C-6His), FBPase 1 (E, coli, sapiens Fructose-1, 6-Bisphosphatase 1, recombinant H
Alternative technique: rec

Related Products :

C139 Recombinant Human Fructose-1,6-Bisphosphatase 1, FBPase 1 (E. coli, C-6His) 50 µg 273 € novo e-coli
CD77 Recombinant Human Fructose-1,6-Bisphosphatase 1, FBPase 1 (C-6His) 1 mg 2283 € novo human
CI45 Recombinant Human Fructose-2,6-Bisphosphatase 1, PFKFB1, PFK, FBPase 1 (C-6His) 10 µg 202 € novo human
GENTAUR-58bb3e484999d Cyanothece sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (cce_3974) 100ug 1989 € MBS Recombinant Proteins human
GENTAUR-58bb3e48978b1 Cyanothece sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (cce_3974) 1000ug 1989 € MBS Recombinant Proteins human
GENTAUR-58bb3e48dae59 Cyanothece sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (cce_3974) 100ug 2498 € MBS Recombinant Proteins human
GENTAUR-58bb3e4923b42 Cyanothece sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (cce_3974) 1000ug 2498 € MBS Recombinant Proteins human
GENTAUR-58bd14a354026 Microcystis aeruginosa D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (MAE_30020) 100ug 1989 € MBS Recombinant Proteins human
GENTAUR-58bd14a39d479 Microcystis aeruginosa D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (MAE_30020) 1000ug 1989 € MBS Recombinant Proteins human
GENTAUR-58bd14a3e7f42 Microcystis aeruginosa D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (MAE_30020) 100ug 2498 € MBS Recombinant Proteins human
GENTAUR-58bd14a42ef2b Microcystis aeruginosa D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (MAE_30020) 1000ug 2498 € MBS Recombinant Proteins human
GENTAUR-58bcf1038cdc1 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (NATL1_08051) 100ug 1956 € MBS Recombinant Proteins human
GENTAUR-58bcf103c8f29 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (NATL1_08051) 1000ug 1956 € MBS Recombinant Proteins human
GENTAUR-58bcf1041ed81 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (NATL1_08051) 100ug 2470 € MBS Recombinant Proteins human
GENTAUR-58bcf1046d45f Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (NATL1_08051) 1000ug 2470 € MBS Recombinant Proteins human
GENTAUR-58b9c280439f2 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (P9301_08271) 100ug 1956 € MBS Recombinant Proteins human
GENTAUR-58b9c28099f77 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (P9301_08271) 1000ug 1956 € MBS Recombinant Proteins human
GENTAUR-58b9c28112857 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (P9301_08271) 100ug 2470 € MBS Recombinant Proteins human
GENTAUR-58b9c28170cc8 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (P9301_08271) 1000ug 2470 € MBS Recombinant Proteins human
GENTAUR-58bb8c0ae4665 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (P9303_16831) 100ug 1956 € MBS Recombinant Proteins human
GENTAUR-58bb8c0b3d188 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (P9303_16831) 1000ug 1956 € MBS Recombinant Proteins human
GENTAUR-58bb8c0b88138 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (P9303_16831) 100ug 2470 € MBS Recombinant Proteins human
GENTAUR-58bb8c0bd7931 Prochlorococcus marinus D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (P9303_16831) 1000ug 2470 € MBS Recombinant Proteins human
GENTAUR-58bd9470e5912 Synechococcus sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (Syncc9902_1229) 100ug 1956 € MBS Recombinant Proteins human
GENTAUR-58bd94714a087 Synechococcus sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (Syncc9902_1229) 1000ug 1956 € MBS Recombinant Proteins human
GENTAUR-58bd9471ae9e2 Synechococcus sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (Syncc9902_1229) 100ug 2470 € MBS Recombinant Proteins human
GENTAUR-58bd9472090ce Synechococcus sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (Syncc9902_1229) 1000ug 2470 € MBS Recombinant Proteins human
GENTAUR-58b9aeb0d8c74 Synechococcus sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (SYNPCC7002_A1301) 100ug 1989 € MBS Recombinant Proteins human
GENTAUR-58b9aeb14ccfc Synechococcus sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (SYNPCC7002_A1301) 1000ug 1989 € MBS Recombinant Proteins human
GENTAUR-58b9aeb1c71b1 Synechococcus sp. D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (SYNPCC7002_A1301) 100ug 2498 € MBS Recombinant Proteins human