| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Lymphotoxin beta receptor is produced by our Mammalian expression system and the target gene encoding Gln31-Met227 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
48, 8 kD |
| UniProt number: |
P36941 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
LTBR, R, TNFRSF3, TNFRrp (C-Fc), Lymphotoxin &beta |
| Short name: |
LTBR, R, TNFRSF3, TNFRrp (C-Fc), Recombinant Lymphotoxin &beta |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
R, TNFRSF3, TNFRrp (C-fragment c), lymphotoxin b receptor (TNFR superfamily, member 3), sapiens Lymphotoxin &beta, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD18 and D12S370 and LT-BETA-R and TNF-R-III and TNFCR and TNFR-RP and TNFR2-RP and TNFR3 and TNFRSF3, LTBR and IDBG-13973 and ENSG00000111321 and 102724071, LTBR and IDBG-640501 and ENSBTAG00000015312 and 504653, Ltbr and IDBG-189788 and ENSMUSG00000030339 and 17000, Plasma membranes, identical protein binding, member 3), this GO :0005515 and protein binding and molecular function this GO :0006915 and apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0042802 and identical protein binding and molecular function this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0045087 and innate immune response and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :2001238 and positive regulation of extrinsic apoptotic signaling pathway and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0031625 : ubiquitin protein ligase binding and also this GO :0042802 : identical protein binding, this GO :0031625 : ubiquitin protein ligase binding, this GO :0042802 : identical protein binding, 4055, lymphotoxin beta receptor (TNFR superfamily |
| Identity: |
6718 |
| Gene: |
LTBR |
More about : LTBR |
| Long gene name: |
lymphotoxin beta receptor |
| Synonyms gene: |
D12S370 |
| Synonyms: |
TNFCR TNFR-RP TNFR2-RP TNF-R-III TNFRSF3 |
| Synonyms name: |
TNFR superfamily, member 3 |
| Locus: |
12p13 |
| Discovery year: |
1996-03-12 |
| GenBank acession: |
L04270 |
| Entrez gene record: |
4055 |
| Pubmed identfication: |
8171323 8486360 |
| Classification: |
Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000168356 |