| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Lymphotoxin beta Receptor is produced by our Mammalian expression system and the target gene encoding Gln31-Met227 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
22, 79 kD |
| UniProt number: |
P36941 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
LTBR, R, TNFRSF3, TNFRrpv (C-6His), Lymphotoxin &beta |
| Short name: |
LTBR, R, TNFRSF3, TNFRrpv (C-6His), Recombinant Lymphotoxin &beta |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
R, TNFRSF3, TNFRrpv (C-6His), lymphotoxin b receptor (TNFR superfamily, member 3), sapiens Lymphotoxin &beta, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD18 and D12S370 and LT-BETA-R and TNF-R-III and TNFCR and TNFR-RP and TNFR2-RP and TNFR3 and TNFRSF3, LTBR and IDBG-13973 and ENSG00000111321 and 102724071, LTBR and IDBG-640501 and ENSBTAG00000015312 and 504653, Ltbr and IDBG-189788 and ENSMUSG00000030339 and 17000, Plasma membranes, identical protein binding, member 3), this GO :0005515 and protein binding and molecular function this GO :0006915 and apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0042802 and identical protein binding and molecular function this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0045087 and innate immune response and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :2001238 and positive regulation of extrinsic apoptotic signaling pathway and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0031625 : ubiquitin protein ligase binding and also this GO :0042802 : identical protein binding, this GO :0031625 : ubiquitin protein ligase binding, this GO :0042802 : identical protein binding, 4055, lymphotoxin beta receptor (TNFR superfamily |
| Identity: |
6718 |
| Gene: |
LTBR |
More about : LTBR |
| Long gene name: |
lymphotoxin beta receptor |
| Synonyms gene: |
D12S370 |
| Synonyms: |
TNFCR TNFR-RP TNFR2-RP TNF-R-III TNFRSF3 |
| Synonyms name: |
TNFR superfamily, member 3 |
| Locus: |
12p13 |
| Discovery year: |
1996-03-12 |
| GenBank acession: |
L04270 |
| Entrez gene record: |
4055 |
| Pubmed identfication: |
8171323 8486360 |
| Classification: |
Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000168356 |