Recombinant Human TRAIL R3, TNFRSF10C, CD263 (C-Fc-6His)

Contact us
Catalog number: CD17
Price: 311 €
Supplier: acr
Product name: Recombinant Human TRAIL R3, TNFRSF10C, CD263 (C-Fc-6His)
Quantity: 25 Вµg
Other quantities: 1 mg 912€ 10 µg 100€ 500 µg 709€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Human TRAIL receptor 3 is produced by our Mammalian expression system and the target gene encoding Ala26-Ala221 is expressed with a Fc
Molecular Weight: 48, 7 kD
UniProt number: O14798
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD263 (C-Fc-6His), TNFRSF10C, TRAIL R3
Short name: CD263 (C-Fc-6His), TNFRSF10C, Recombinant TRAIL R3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD263 (C-fragment c-6His), decoy without an intracellular domain, member 10c, sapiens TRAIL R3, tumor necrosis factor receptor superfamily, recombinant H
Alternative technique: rec
Alternative to gene target: CD263 and DCR1 and DCR1-TNFR and LIT and TRAIL-R3 and TRAILR3 and TRID, Plasma membranes, TNFRSF10C and IDBG-11572 and ENSG00000173535 and 8794, TRAIL binding, decoy without an intracellular domain, member 10c, this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0031225 and anchored component of membrane and cellular component this GO :0045569 and TRAIL binding and molecular function, this GO :0004888 : transmembrane signaling receptor activity, this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005515 : protein binding and also this GO :0045569 : TRAIL binding, this GO :0005515 : protein binding, this GO :0045569 : TRAIL binding, tumor necrosis factor receptor superfamily
Identity: 11906
Gene: TNFRSF10C | More about : TNFRSF10C
Long gene name: TNF receptor superfamily member 10c
Synonyms gene name: decoy without an intracellular domain , member 10c, tumor necrosis factor receptor superfamily
Synonyms: DcR1 TRAILR3 LIT TRID CD263
Locus: 8p21, 3
Discovery year: 1998-12-04
GenBank acession: AF012536
Entrez gene record: 8794
Pubmed identfication: 9314565 9325248
Classification: CD molecules Tumor necrosis factor receptor superfamily
Havana BLAST/BLAT: OTTHUMG00000097844

Related Products :

C504 Recombinant Human TRAIL R3, TNFRSF10C, CD263 (C-6His) 10 µg 90 € novo human
CD17 Recombinant Human TRAIL R3, TNFRSF10C, CD263 (C-Fc-6His) 500 µg 709 € novo human
RP-1556H Recombinant Human TRAILR3 / TNFRSF10C Protein (His Tag) 20μg 346 € adv human
C326 Recombinant Human TRAIL R2, TNFRSF10B, DR5, CD262 (C-6His) 500 µg 831 € novo human
CD31 Recombinant Human TRAIL R2, TNFRSF10B, DR5, CD262 (C-Fc-6His) 50 µg 202 € novo human
CG92 Recombinant Human TRAIL, TNFSF10, CD253 (Val114-Gly281, C-6His) 1 mg 1674 € novo human
101-M653 Anti-Human TNFRSF10C 100ug 336 € Reliatech antibodies human
GENTAUR-58bca8ffad89f Human Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C) 100ug 1641 € MBS Recombinant Proteins human
GENTAUR-58bca900086d7 Human Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C) 1000ug 1641 € MBS Recombinant Proteins human
GENTAUR-58bca90045945 Human Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C) 100ug 2155 € MBS Recombinant Proteins human
GENTAUR-58bca90092765 Human Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C) 1000ug 2155 € MBS Recombinant Proteins human
GENTAUR-58bdff6974f57 Anti- TNFRSF10C Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdff6a17927 Anti- TNFRSF10C Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be4171355e0 Anti- TNFRSF10C Antibody 100ug 393 € MBS Polyclonals human
abx216579 Anti-TNFRSF10C Antibody inquire 50 € abbex human
abx937585 Anti-TNFRSF10C siRNA 30 nmol 717 € abbex human
GWB-43C07D TNFRSF10C Over-expression Lysate reagent 1 x 1 vial 562 € genways human
MBS128159 TNFRSF10C Polyclonal Antibody 50ug 304 € MBS Polyclonals_1 human
MBS221822 Anti-HUMAN CD263 100ug 464 € MBS Polyclonals_1 human
GENTAUR-58bde193946ed MOUSE Anti-HUMAN CD263 Antibody 200ug 531 € MBS mono human
GENTAUR-58bde379ca3d0 MOUSE Anti-HUMAN CD263 Antibody 0.025 miligrams 205 € MBS mono human
abx139961 Anti-CD263 Antibody (Azide free) 0.1 mg 412 € abbex human
abx139964 Anti-CD263 Antibody (FITC) inquire 50 € abbex human
abx139963 Anti-CD263 Antibody (PE) inquire 50 € abbex human
AR51875PU-N anti-CD263 / TRAILR3 (26-236, His-tag) Antibody 0,5 mg 1109 € acr human
AR51875PU-S anti-CD263 / TRAILR3 (26-236, His-tag) Antibody 0,1 mg 485 € acr human
AM01323FC-N anti-CD263 / TRAILR3 Antibody 0,1 mg 630 € acr human
AM01323FC-T anti-CD263 / TRAILR3 Antibody 25 Вµg 326 € acr human
AM01323PU-N anti-CD263 / TRAILR3 Antibody 0,2 mg 761 € acr human
AM01323PU-T anti-CD263 / TRAILR3 Antibody 25 Вµg 311 € acr human