| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
6His tag at the C-terminus, Recombinant Human TRAIL receptor 3 is produced by our Mammalian expression system and the target gene encoding Ala26-Ala221 is expressed with a Fc |
| Molecular Weight: |
48, 7 kD |
| UniProt number: |
O14798 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD263 (C-Fc-6His), TNFRSF10C, TRAIL R3 |
| Short name: |
CD263 (C-Fc-6His), TNFRSF10C, Recombinant TRAIL R3 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD263 (C-fragment c-6His), decoy without an intracellular domain, member 10c, sapiens TRAIL R3, tumor necrosis factor receptor superfamily, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD263 and DCR1 and DCR1-TNFR and LIT and TRAIL-R3 and TRAILR3 and TRID, Plasma membranes, TNFRSF10C and IDBG-11572 and ENSG00000173535 and 8794, TRAIL binding, decoy without an intracellular domain, member 10c, this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0031225 and anchored component of membrane and cellular component this GO :0045569 and TRAIL binding and molecular function, this GO :0004888 : transmembrane signaling receptor activity, this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005515 : protein binding and also this GO :0045569 : TRAIL binding, this GO :0005515 : protein binding, this GO :0045569 : TRAIL binding, tumor necrosis factor receptor superfamily |
| Identity: |
11906 |
| Gene: |
TNFRSF10C |
More about : TNFRSF10C |
| Long gene name: |
TNF receptor superfamily member 10c |
| Synonyms gene name: |
decoy without an intracellular domain , member 10c, tumor necrosis factor receptor superfamily |
| Synonyms: |
DcR1 TRAILR3 LIT TRID CD263 |
| Locus: |
8p21, 3 |
| Discovery year: |
1998-12-04 |
| GenBank acession: |
AF012536 |
| Entrez gene record: |
8794 |
| Pubmed identfication: |
9314565 9325248 |
| Classification: |
CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000097844 |