Recombinant Human Butyrophilin 3A2, BTN3A2 (C-6His)

Contact us
Catalog number: CC91
Price: 50 €
Supplier: abbex
Product name: Recombinant Human Butyrophilin 3A2, BTN3A2 (C-6His)
Quantity: inquire
Other quantities: 1 mg 2486€ 50 µg 496€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Butyrophilin 3A2 is produced by our Mammalian expression system and the target gene encoding Gln30-Trp248 is expressed with a 6His tag at the C-terminus
Molecular Weight: 24, 6 kD
UniProt number: P78410
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPWVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: BTN3A2 (C-6His), Butyrophilin 3A2
Short name: BTN3A2 (C-6His), Recombinant Butyrophilin 3A2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: BTN3A2 (C-6His), sapiens Butyrophilin 3A2, recombinant H
Alternative technique: rec
Identity: 1139
Gene: BTN3A2 | More about : BTN3A2
Long gene name: butyrophilin subfamily 3 member A2
Synonyms gene name: butyrophilin, member A2 , subfamily 3
Synonyms: BTN3, 2
Locus: 6p22, 2
Discovery year: 1999-08-27
GenBank acession: U90546
Entrez gene record: 11118
Pubmed identfication: 9149941
Classification: V-set domain containing Butyrophilins
Havana BLAST/BLAT: OTTHUMG00000014450

Related Products :

CC91 Recombinant Human Butyrophilin 3A2, BTN3A2 (C-6His) 10 µg 202 € novo human
C514 Recombinant Human Butyrophilin 1A1, BTN1A1 (C-6His) 50 µg 369 € novo human
CC72 Recombinant Human Butyrophilin 3A3, BTN3A3 (C-6His) 50 µg 303 € novo human
CS10 Recombinant Mouse Butyrophilin Subfamily 1 Member A1, BTN1A1 (C-6His) 10 µg 146 € novo mouse
LV091726 BTN3A2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV091727 BTN3A2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV091728 BTN3A2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV091729 BTN3A2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV091731 BTN3A2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV091730 BTN3A2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
YSGKAMCC025E MCM 3, ~102kD, Clone: 3A2, Mouse Monoclonal antibody-Human; WB/IP/IHC 0.1mg 1293 € accurate-monoclonals human
GENTAUR-58bde6de9884b Mouse Monoclonal [clone 3A2] (IgG2b,k) to Human ART3 Antibody 50ug 663 € MBS mono human
GENTAUR-58bde76f1a6f3 Mouse Monoclonal [clone SN4/C3-3A2] (IgG1) to Human CD9 Antibody 50ug 597 € MBS mono human
C564 Recombinant Human Butyrophilin Subfamily 3 Member A1, BTN3A1, CD277 (C-Fc) 500 µg 963 € novo human
GENTAUR-58bdf984ca092 Anti- BTN3A2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf98528e1c Anti- BTN3A2 Antibody 0.12 ml 348 € MBS Polyclonals human
abx909398 Anti-BTN3A2 siRNA inquire 50 € abbex human
abx256527 Anti-Rat Cytochrome P450 3A2 ELISA Kit inquire 50 € abbex rat
YSRTMCA3991Z ART3, Mouse Monoclonal antibody-; Clone: 3A2 0.1 mg Ask price € accurate-monoclonals mouse
APO-000419-M05 ART3 Mouse Monoclonal Antibody (M05), clone 3A2 0.1mg 495 € Zyagen mouse
YSRTMCA2955Z ATP6AP1, Mouse Monoclonal antibody-; Clone: 3A2, WB, Azide Free 0.1 mg Ask price € accurate-monoclonals mouse
GENTAUR-58be353baaca2 BTN3A2 antibody 100ul 707 € MBS mono human
GWB-51FEF6 BTN3A2 antibody 1 x 1 vial 665 € genways human
GWB-A633FA BTN3A2 Over-expression Lysate reagent 1 vial 463 € genways human
YSRTMCA4962Z PROX1, Mouse Monoclonal antibody-; Clone: 3A2 0.1 mg Ask price € accurate-monoclonals mouse
CEL-005629-M05 PROX1 Mouse Monoclonal Antibody (M05), clone 3A2 0.1mg 495 € Zyagen mouse
TRA-115273-M03 RAB42 Mouse Monoclonal Antibody (M03), clone 3A2 0.1mg 495 € Zyagen mouse
YSRTMCA4151Z SLC18A1, Mouse Monoclonal antibody-; Clone: 3A2-E10 0.1 mg Ask price € accurate-monoclonals mouse
TRA-084107-M09 ZIC4 Mouse Monoclonal Antibody (M09), clone 3A2 0.1mg 495 € Zyagen mouse
abx250941 Anti-Human Butyrophilin subfamily 2 member A1 ELISA Kit inquire 50 € abbex human