| Catalog number: | C564 |
|---|---|
| Price: | 630 € |
| Supplier: | MBS mono |
| Product name: | Recombinant Human Butyrophilin Subfamily 3 Member A1, BTN3A1, CD277 (C-Fc) |
| Quantity: | 100ug |
| Other quantities: | 1 mg 1318€ 10 µg 126€ 50 µg 278€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human Butyrophilin Subfamily 3 Member A1 is produced by our Mammalian expression system and the target gene encoding Gln30-Gly254 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: | 50, 8 kD |
| UniProt number: | O00481 |
| State of the product: | Freeze-dried |
| Shipping conditions: | Ambient temperature |
| Formulation: | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | BTN3A1, CD277 (C-Fc), Butyrophilin Subfamily 3 Member A1 |
| Short name: | BTN3A1, CD277 (C-Fc), Recombinant Butyrophilin Subfamily 3 Member A1 |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | BTN3A1, CD277 (C-fragment c), sapiens Butyrophilin Subfamily 3 Member A1, recombinant H |
| Alternative technique: | rec |
| Identity: | 1138 |
| Gene: | BTN3A1 | More about : BTN3A1 |
| Long gene name: | butyrophilin subfamily 3 member A1 |
| Synonyms gene name: | butyrophilin, member A1 , subfamily 3 |
| Synonyms: | BT3, 1 , 1 BTF5 CD277 BTN3 |
| Locus: | 6p22, 2 |
| Discovery year: | 1999-08-27 |
| GenBank acession: | U90552 |
| Entrez gene record: | 11119 |
| Pubmed identfication: | 9149941 |
| Classification: | C2-set domain containing CD molecules V-set domain containing Butyrophilins |
| Havana BLAST/BLAT: | OTTHUMG00000014449 |
| C564 | Recombinant Human Butyrophilin Subfamily 3 Member A1, BTN3A1, CD277 (C-Fc) | 500 µg | 963 € | novo | human |
| GENTAUR-58b8c58243091 | Human Butyrophilin subfamily 3 member A1 (BTN3A1) | 100ug | 1680 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8c582b7f39 | Human Butyrophilin subfamily 3 member A1 (BTN3A1) | 1000ug | 1680 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8c583230e7 | Human Butyrophilin subfamily 3 member A1 (BTN3A1) | 100ug | 2194 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8c58389800 | Human Butyrophilin subfamily 3 member A1 (BTN3A1) | 1000ug | 2194 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9c6517908b | Human Butyrophilin subfamily 3 member A1 (BTN3A1) | 100ug | 1680 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9c651e6d64 | Human Butyrophilin subfamily 3 member A1 (BTN3A1) | 1000ug | 1680 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9c6523e681 | Human Butyrophilin subfamily 3 member A1 (BTN3A1) | 100ug | 2194 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9c653b62fc | Human Butyrophilin subfamily 3 member A1 (BTN3A1) | 1000ug | 2194 € | MBS Recombinant Proteins | human |
| CS10 | Recombinant Mouse Butyrophilin Subfamily 1 Member A1, BTN1A1 (C-6His) | 10 µg | 146 € | novo | mouse |
| abx250941 | Anti-Human Butyrophilin subfamily 2 member A1 ELISA Kit | inquire | 50 € | abbex | human |
| DL-BTN1A1-Hu | Human Butyrophilin Subfamily 1, Member A1 BTN1A1 ELISA Kit | 96T | 904 € | DL elisas | human |
| GENTAUR-58b381877b5cc | Human Butyrophilin subfamily 3 member A3 (BTN3A3) | 100ug | 1663 € | MBS Recombinant Proteins | human |
| GENTAUR-58b38187a8f08 | Human Butyrophilin subfamily 3 member A3 (BTN3A3) | 1000ug | 1663 € | MBS Recombinant Proteins | human |
| GENTAUR-58b38187e336e | Human Butyrophilin subfamily 3 member A3 (BTN3A3) | 100ug | 2177 € | MBS Recombinant Proteins | human |
| GENTAUR-58b381882076a | Human Butyrophilin subfamily 3 member A3 (BTN3A3) | 1000ug | 2177 € | MBS Recombinant Proteins | human |
| GENTAUR-58b43a2c4c2d1 | Human Butyrophilin subfamily 3 member A3 (BTN3A3) | 100ug | 1663 € | MBS Recombinant Proteins | human |
| GENTAUR-58b43a2c8fe9b | Human Butyrophilin subfamily 3 member A3 (BTN3A3) | 1000ug | 1663 € | MBS Recombinant Proteins | human |
| GENTAUR-58b43a2cf283c | Human Butyrophilin subfamily 3 member A3 (BTN3A3) | 100ug | 2177 € | MBS Recombinant Proteins | human |
| GENTAUR-58b43a2d7c8cb | Human Butyrophilin subfamily 3 member A3 (BTN3A3) | 1000ug | 2177 € | MBS Recombinant Proteins | human |
| EKU02817 | Butyrophilin Subfamily 1, Member A1 (BTN1A1) ELISA kit | 1 plate of 96 wells | 822 € | Biomatik ELISA kits | human |
| GENTAUR-58bb04b9150a2 | Mouse Butyrophilin subfamily 2 member A2 (Btn2a2) | 100ug | 1652 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bb04b94e7fa | Mouse Butyrophilin subfamily 2 member A2 (Btn2a2) | 1000ug | 1652 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bb04b99a2af | Mouse Butyrophilin subfamily 2 member A2 (Btn2a2) | 100ug | 2166 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bb04b9e397e | Mouse Butyrophilin subfamily 2 member A2 (Btn2a2) | 1000ug | 2166 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bb30815e735 | Mouse Butyrophilin subfamily 2 member A2 (Btn2a2) | 100ug | 1652 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bb3081a8b16 | Mouse Butyrophilin subfamily 2 member A2 (Btn2a2) | 1000ug | 1652 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bb308203b53 | Mouse Butyrophilin subfamily 2 member A2 (Btn2a2) | 100ug | 2166 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bb30824f1f6 | Mouse Butyrophilin subfamily 2 member A2 (Btn2a2) | 1000ug | 2166 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58be379923a90 | CD277 antibody | 100ug | 630 € | MBS mono | human |