Recombinant Human CEACAM21 (C-6His)

Contact us
Catalog number: CC88
Price: 2486 €
Supplier: novo
Product name: Recombinant Human CEACAM21 (C-6His)
Quantity: 1 mg
Other quantities: 1 mg 2486€ 50 µg 496€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CEACAM21 is produced by our Mammalian expression system and the target gene encoding Trp35-Gly240 is expressed with a 6His tag at the C-terminus
Molecular Weight: 2 kD, 24
UniProt number: Q3KPI0
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: WLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYESVAQPSIQASSTTVTEKGSVVLTCHTNNTGTSFQWIFNNQRLQVTKRMKLSWFNHVLTIDPIRQEDAGEYQCEVSNPVSSNRSDPLKLTVKSDDNTLGVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CEACAM21 (C-6His)
Short name: Recombinant CEACAM21 (C-6His)
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens carcinoembryonic protein-related cellular adhesion molecule 21 (C-6His), recombinant H
Alternative technique: rec
Alternative to gene target: CEACAM21 and IDBG-53114 and ENSG00000007129 and 90273, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0016021 and integral component of membrane and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding, carcinoembryonic antigen-related cell adhesion molecule 21
Identity: 28834
Gene: CEACAM21 | More about : CEACAM21
Long gene name: carcinoembryonic antigen related cell adhesion molecule 21
Synonyms gene name: carcinoembryonic antigen-related cell adhesion molecule 21
Synonyms: R29124_1 FLJ13540
Locus: 19q13, 2
Discovery year: 2005-07-25
GenBank acession: AK023602
Entrez gene record: 90273
Pubmed identfication: 12477932
RefSeq identity: NM_033543
Classification: Immunoglobulin like domain containing V-set domain containing Carcinoembryonic antigen related cell adhesion molecule family
Havana BLAST/BLAT: OTTHUMG00000151062

Related Products :

CC88 Recombinant Human CEACAM21 (C-6His) 50 µg 496 € novo human
GWB-ATG382 CEACAM21, 35-240aa, Human, His tag, E.coli bulk Ask price € genways bulk human
LV115693 CEACAM21 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV115694 CEACAM21 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV115695 CEACAM21 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV115696 CEACAM21 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV115698 CEACAM21 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV115697 CEACAM21 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
AR51078PU-N anti-CEACAM21 (35-240, His-tag) Antibody 0,5 mg 1413 € acr human
AR51078PU-S anti-CEACAM21 (35-240, His-tag) Antibody 0,1 mg 587 € acr human
A01C0229 anti-CEACAM21 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
CPA3449-100ul anti-CEACAM21 Antibody 0,1 ml 442 € acr human
CPA3449-200ul anti-CEACAM21 Antibody 0,2 ml 688 € acr human
CPA3449-30ul anti-CEACAM21 Antibody 30 Вµl 326 € acr human
GENTAUR-58bdf16d7d585 Anti- CEACAM21 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf16dd0b6b Anti- CEACAM21 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be11fa44b38 Anti- CEACAM21 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be11fa986bd Anti- CEACAM21 Antibody 0.12 ml 348 € MBS Polyclonals human
abx133955 Anti-CEACAM21 Antibody 200 μl 398 € abbex human
abx148906 Anti-CEACAM21 Antibody 100 μg 311 € abbex human
abx162311 Anti-CEACAM21 Blocking Peptide 5 mg 427 € abbex human
abx911384 Anti-CEACAM21 siRNA 30 nmol 717 € abbex human
bs-7996R CEACAM21 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
GWB-8CF1AE CEACAM21 Over-expression Lysate reagent 1 vial 562 € genways human
C846 Recombinant Human Galectin-3, LGALS3 (C-6His, Human Cells) 50 µg 303 € novo human
CC79 Recombinant Human GM-CSF, CSF2 (C-6His, Human Cells) 10 µg 146 € novo human
CD98 Recombinant Human NGAL, Lipocalin-2, LCN2 (C-6His, Human Cells) 500 µg 1613 € novo human
CB01 Recombinant Human SOD2, Mn-SOD (C-6His, Human Cells) 500 µg 1613 € novo human
C848 Recombinant Human 15-PGDH, HPGD (C-6His) 500 µg 1613 € novo human
CI63 Recombinant Human 17β-Hydroxysteroid Dehydrogenase 10, HSD17B10 (C-6His) 1 mg 2486 € novo human