Recombinant Human Ketohexokinase, KHK (C-6His)

Catalog number:	CC61 Buy Now
Price:	322 €
Supplier:	ABM lentivectors
Product name:	Recombinant Human Ketohexokinase, KHK (C-6His)
Quantity:	1.0 µg DNA
Other quantities:	1 mg 2283€ 50 µg 339€ 500 µg 1613€
Related search:	human gene khk sapiens chis fructokinase produced

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Ketohexokinase is produced by our Mammalian expression system and the target gene encoding Met1-Val298 is expressed with a 6His tag at the C-terminus
Molecular Weight:	33, 7 kD
UniProt number:	P50053
State of the product:	Liquid
Shipping conditions:	Dry ice/ice packs
Formulation:	10%Glycerol, 2 um filtered solution of 20 mM TrisHCl, 4, 50nM KCl, Supplied as a 0, pH7
Storage recommendations:	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution:	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIVVDHHHHHH
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	KHK (C-6His), Ketohexokinase
Short name:	KHK (C-6His), Recombinant Ketohexokinase
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	KHK (C-6His), sapiens Ketohexokinase, recombinant H
Alternative technique:	rec
Identity:	6315
Gene:	KHK | More about : KHK
Long gene name:	ketohexokinase
Synonyms gene name:	ketohexokinase (fructokinase)
Synonyms name:	fructokinase
Locus:	2p23, 3
Discovery year:	1994-12-19
Entrez gene record:	3795
Pubmed identfication:	7833921
Havana BLAST/BLAT:	OTTHUMG00000097077

• #human
• #gene
• #khk
• #sapiens
• #chis
• #fructokinase
• #produced