Recombinant Human Ketohexokinase, KHK (C-6His)

Contact us
Catalog number: CC61
Price: 322 €
Supplier: ABM lentivectors
Product name: Recombinant Human Ketohexokinase, KHK (C-6His)
Quantity: 1.0 µg DNA
Other quantities: 10 µg 146€ 50 µg 339€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Ketohexokinase is produced by our Mammalian expression system and the target gene encoding Met1-Val298 is expressed with a 6His tag at the C-terminus
Molecular Weight: 33, 7 kD
UniProt number: P50053
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10%Glycerol, 2 um filtered solution of 20 mM TrisHCl, 4, 50nM KCl, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIVVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: KHK (C-6His), Ketohexokinase
Short name: KHK (C-6His), Recombinant Ketohexokinase
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: KHK (C-6His), sapiens Ketohexokinase, recombinant H
Alternative technique: rec
Identity: 6315
Gene: KHK | More about : KHK
Long gene name: ketohexokinase
Synonyms gene name: ketohexokinase (fructokinase)
Synonyms name: fructokinase
Locus: 2p23, 3
Discovery year: 1994-12-19
Entrez gene record: 3795
Pubmed identfication: 7833921
Havana BLAST/BLAT: OTTHUMG00000097077

Related Products :

CC61 Recombinant Human Ketohexokinase, KHK (C-6His) 10 µg 146 € novo human
AE36987MO-48 ELISA test for Mouse Ketohexokinase (KHK) 1x plate of 48 wells 373 € abebio mouse
MBS624024 Ketohexokinase, CT (KHK, Hepatic Fructokinase) Antibody 200ul 603 € MBS Polyclonals_1 human
AE36987MO Mouse Ketohexokinase (KHK) ELISA Kit 48 wells plate 480 € ab-elisa elisas mouse
AE36987MO-96 Mouse Ketohexokinase (KHK) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
GWB-833B35 Recombinant Human Ketohexokinase bulk Ask price € genways bulk human
GWB-P1601B Ketohexokinase, 1-298aa, Recombinant Protein bulk Ask price € genways bulk human
XW-RP3126 KHK Recombinant Protein 0.05 mg 422 € proscience human
abx251381 Anti-Human Ketohexokinase ELISA Kit 96 tests 659 € abbex human
AR09320PU-L anti-Ketohexokinase (1-298) Antibody 0,5 mg 1022 € acr human
AR09320PU-N anti-Ketohexokinase (1-298) Antibody 0,1 mg 413 € acr human
abx141983 Anti-Ketohexokinase Antibody 50 μl 311 € abbex human
AP13634PU-N anti-Ketohexokinase (C-term) Antibody 0,4 ml 587 € acr human
AP13633PU-N anti-Ketohexokinase (N-term) Antibody 0,4 ml 587 € acr human
GENTAUR-58be6258d0769 Anti-Ketohexokinase (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
GWB-5AEC35 Ketohexokinase bulk Ask price € genways bulk human
bs-4045R-A350 Ketohexokinase Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-4045R-A488 Ketohexokinase Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-4045R-A555 Ketohexokinase Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-4045R-A594 Ketohexokinase Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-4045R-A647 Ketohexokinase Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-4045R-Biotin Ketohexokinase Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-4045R Ketohexokinase Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-4045R-Cy3 Ketohexokinase Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-4045R-Cy5 Ketohexokinase Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-4045R-Cy5.5 Ketohexokinase Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-4045R-Cy7 Ketohexokinase Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-4045R-FITC Ketohexokinase Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-4045R-HRP Ketohexokinase Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
LV197595 KHK Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human