| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
6His tag at the C-terminus, Recombinant Human Lymphotactin is produced by our Mammalian expression system and the target gene encoding Val22-Gly114 is expressed with a Fc |
| Molecular Weight: |
4 kD, 40 |
| UniProt number: |
P47992 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4 , Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
LTN, XCL1 (C-Fc-6His), Lymphotactin |
| Short name: |
LTN, XCL1 (C-Fc-6His), Recombinant Lymphotactin |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
LTN, chemokine (C motif) ligand 1 (C-fragment c-6His), sapiens Lymphotactin, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ATAC and LPTN and LTN and SCM-1 and SCM-1a and SCM1 and SCM1A and SCYC1, DNA-templated and biological process this GO :0050727 and regulation of inflammatory response and biological process this GO :0051209 and release of sequestered calcium ion into cytosol and biological process this GO :0051281 and positive regulation of release of sequestered calcium ion into cytosol and biological process this GO :0071353 and cellular response to interleukin-4 and biological process this GO :0071560 and cellular response to transforming growth factor beta stimulus and biological process this GO :0071636 and positive regulation of transforming growth factor beta production and biological process this GO :0071663 and positive regulation of granzyme B production and biological process this GO :0090023 and positive regulation of neutrophil chemotaxis and biological process this GO :2000412 and positive regulation of thymocyte migration and biological process this GO :2000503 and positive regulation of natural killer cell chemotaxis and biological process this GO :2000513 and positive regulation of granzyme A production and biological process this GO :2000518 and negative regulation of T-helper 1 cell activation and biological process this GO :2000538 and positive regulation of B cell chemotaxis and biological process this GO :2000553 and positive regulation of T-helper 2 cell cytokine production and biological process this GO :2000556 and positive regulation of T-helper 1 cell cytokine production and biological process this GO :2000558 and positive regulation of immunoglobulin production in mucosal tissue and biological process this GO :2000562 and negative regulation of CD4-positive, Extracellular, XCL1 and IDBG-104633 and ENSG00000143184 and 6375, alpha-beta T cell proliferation and biological process, alpha-beta T cell proliferation and biological process this GO :2000563 and positive regulation of CD4-positive, alpha-beta T cell proliferation and biological process this GO :2000566 and positive regulation of CD8-positive, protein homodimerization activity, this GO :0001916 and positive regulation of T cell mediated cytotoxicity and biological process this GO :0002690 and positive regulation of leukocyte chemotaxis and biological process this GO :0002725 and negative regulation of T cell cytokine production and biological process this GO :0002726 and positive regulation of T cell cytokine production and biological process this GO :0002826 and negative regulation of T-helper 1 type immune response and biological process this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0009615 and response to virus and biological process this GO :0010820 and positive regulation of T cell chemotaxis and biological process this GO :0030593 and neutrophil chemotaxis and biological process this GO :0032689 and negative regulation of interferon-gamma production and biological process this GO :0032703 and negative regulation of interleukin-2 production and biological process this GO :0032733 and positive regulation of interleukin-10 production and biological process this GO :0035782 and mature natural killer cell chemotaxis and biological process this GO :0042379 and chemokine receptor binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0043433 and negative regulation of sequence-specific DNA binding transcription factor activity and biological process this GO :0045892 and negative regulation of transcription, this GO :0008009 : chemokine activity, this GO :0008009 : chemokine activity and also this GO :0042379 : chemokine receptor binding and also this GO :0042803 : protein homodimerization activity, this GO :0042379 : chemokine receptor binding, this GO :0042803 : protein homodimerization activity, chemokine (C motif) ligand 1 |
| Identity: |
10645 |
| Gene: |
XCL1 |
More about : XCL1 |
| Long gene name: |
X-C motif chemokine ligand 1 |
| Synonyms gene: |
LTN SCYC1 |
| Synonyms gene name: |
member 1 (lymphotactin) chemokine (C motif) ligand 1 , small inducible cytokine subfamily C |
| Synonyms: |
LPTN ATAC SCM-1a SCM-1 |
| Synonyms name: |
lymphotactin |
| Locus: |
1q24, 2 |
| Discovery year: |
1996-03-19 |
| GenBank acession: |
D43768 |
| Entrez gene record: |
6375 |
| Pubmed identfication: |
7602097 7875320 |
| RefSeq identity: |
NM_002995 |
| Classification: |
Chemokine ligands Endogenous ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000034548 |