Recombinant Human Lymphotactin, LTN, XCL1 (C-Fc-6His)

Contact us
Catalog number: CC33
Price: 333 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Human Lymphotactin, LTN, XCL1 (C-Fc-6His)
Quantity: 0.1ml
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Human Lymphotactin is produced by our Mammalian expression system and the target gene encoding Val22-Gly114 is expressed with a Fc
Molecular Weight: 4 kD, 40
UniProt number: P47992
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of phosphate buffered saline, 4 , Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: LTN, XCL1 (C-Fc-6His), Lymphotactin
Short name: LTN, XCL1 (C-Fc-6His), Recombinant Lymphotactin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: LTN, chemokine (C motif) ligand 1 (C-fragment c-6His), sapiens Lymphotactin, recombinant H
Alternative technique: rec
Alternative to gene target: ATAC and LPTN and LTN and SCM-1 and SCM-1a and SCM1 and SCM1A and SCYC1, DNA-templated and biological process this GO :0050727 and regulation of inflammatory response and biological process this GO :0051209 and release of sequestered calcium ion into cytosol and biological process this GO :0051281 and positive regulation of release of sequestered calcium ion into cytosol and biological process this GO :0071353 and cellular response to interleukin-4 and biological process this GO :0071560 and cellular response to transforming growth factor beta stimulus and biological process this GO :0071636 and positive regulation of transforming growth factor beta production and biological process this GO :0071663 and positive regulation of granzyme B production and biological process this GO :0090023 and positive regulation of neutrophil chemotaxis and biological process this GO :2000412 and positive regulation of thymocyte migration and biological process this GO :2000503 and positive regulation of natural killer cell chemotaxis and biological process this GO :2000513 and positive regulation of granzyme A production and biological process this GO :2000518 and negative regulation of T-helper 1 cell activation and biological process this GO :2000538 and positive regulation of B cell chemotaxis and biological process this GO :2000553 and positive regulation of T-helper 2 cell cytokine production and biological process this GO :2000556 and positive regulation of T-helper 1 cell cytokine production and biological process this GO :2000558 and positive regulation of immunoglobulin production in mucosal tissue and biological process this GO :2000562 and negative regulation of CD4-positive, Extracellular, XCL1 and IDBG-104633 and ENSG00000143184 and 6375, alpha-beta T cell proliferation and biological process, alpha-beta T cell proliferation and biological process this GO :2000563 and positive regulation of CD4-positive, alpha-beta T cell proliferation and biological process this GO :2000566 and positive regulation of CD8-positive, protein homodimerization activity, this GO :0001916 and positive regulation of T cell mediated cytotoxicity and biological process this GO :0002690 and positive regulation of leukocyte chemotaxis and biological process this GO :0002725 and negative regulation of T cell cytokine production and biological process this GO :0002726 and positive regulation of T cell cytokine production and biological process this GO :0002826 and negative regulation of T-helper 1 type immune response and biological process this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0009615 and response to virus and biological process this GO :0010820 and positive regulation of T cell chemotaxis and biological process this GO :0030593 and neutrophil chemotaxis and biological process this GO :0032689 and negative regulation of interferon-gamma production and biological process this GO :0032703 and negative regulation of interleukin-2 production and biological process this GO :0032733 and positive regulation of interleukin-10 production and biological process this GO :0035782 and mature natural killer cell chemotaxis and biological process this GO :0042379 and chemokine receptor binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0043433 and negative regulation of sequence-specific DNA binding transcription factor activity and biological process this GO :0045892 and negative regulation of transcription, this GO :0008009 : chemokine activity, this GO :0008009 : chemokine activity and also this GO :0042379 : chemokine receptor binding and also this GO :0042803 : protein homodimerization activity, this GO :0042379 : chemokine receptor binding, this GO :0042803 : protein homodimerization activity, chemokine (C motif) ligand 1
Identity: 10645
Gene: XCL1 | More about : XCL1
Long gene name: X-C motif chemokine ligand 1
Synonyms gene: LTN SCYC1
Synonyms gene name: member 1 (lymphotactin) chemokine (C motif) ligand 1 , small inducible cytokine subfamily C
Synonyms: LPTN ATAC SCM-1a SCM-1
Synonyms name: lymphotactin
Locus: 1q24, 2
Discovery year: 1996-03-19
GenBank acession: D43768
Entrez gene record: 6375
Pubmed identfication: 7602097 7875320
RefSeq identity: NM_002995
Classification: Chemokine ligands Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000034548

Related Products :

CC33 Recombinant Human Lymphotactin, LTN, XCL1 (C-Fc-6His) 1 mg 2283 € novo human
RP-1018 Recombinant (E.Coli) Human Lymphotactin (XCL1) 10 μg 333 € adi human
GWB-BIG0C5 Recombinant Human Lymphotactin (XCL1) bulk Ask price € genways bulk human
GWB-A4A724 Recombinant Human Lymphotactin (XCL1) His Tag bulk Ask price € genways bulk human
abx262352 Anti-Lymphotactin (XCL1) His Tag Protein (Recombinant) 10 µg 340 € abbex human
abx260681 Anti-Lymphotactin (XCL1) Protein (Recombinant) 2x10 µg 340 € abbex human
GWB-P1721E Lymphotactin/XCL1, 22-114 aa, Recombinant Protein bulk Ask price € genways bulk human
GENTAUR-58bde72076010 Mouse Monoclonal [clone 1E1] (IgG2a,k) to Human XCL1 / Lymphotactin Antibody 50ug 663 € MBS mono human
GENTAUR-58be5afb79611 Anti-Lymphotactin/Xcl1 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
AM31697PU-N anti-XCL1 / Lymphotactin (22-114) Antibody 50 Вµg 819 € acr human
AR09197PU-L anti-XCL1 / Lymphotactin (22-114, His-tag) Antibody 0,25 mg 1138 € acr human
AR09197PU-N anti-XCL1 / Lymphotactin (22-114, His-tag) Antibody 50 Вµg 485 € acr human
BB-PA1406 anti-XCL1 / Lymphotactin Antibody 0,1 mg 471 € acr human
PA097 anti-XCL1 / Lymphotactin Antibody 5 Вµg 253 € acr human
PA097X anti-XCL1 / Lymphotactin Antibody 20 Вµg 384 € acr human
PP1043B1 anti-XCL1 / Lymphotactin Antibody 25 Вµg 384 € acr human
PP1043B2 anti-XCL1 / Lymphotactin Antibody 50 Вµg 543 € acr human
PP1043P1 anti-XCL1 / Lymphotactin Antibody 50 Вµg 384 € acr human
PP1043P2 anti-XCL1 / Lymphotactin Antibody 0,1 mg 543 € acr human
TP204 anti-XCL1 / Lymphotactin Antibody 0,2 mg 471 € acr human
TP204AF anti-XCL1 / Lymphotactin Antibody 0,2 mg 471 € acr human
TP205 anti-XCL1 / Lymphotactin Antibody 0,2 mg 471 € acr human
TP205AF anti-XCL1 / Lymphotactin Antibody 0,2 mg 471 € acr human
R32109 Lymphotactin Antibody / XCL1 0.1mg 406 € NJS poly human
bs-11287R-A350 Lymphotactin/Xcl1 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11287R-A488 Lymphotactin/Xcl1 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11287R-A555 Lymphotactin/Xcl1 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11287R-A594 Lymphotactin/Xcl1 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11287R-A647 Lymphotactin/Xcl1 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11287R-Biotin Lymphotactin/Xcl1 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human