Recombinant Human IL-2 Receptor Subunit γ, IL-2RG, CD132 (C-Fc-6His)

Contact us
Catalog number: CB64
Price: 126 €
Supplier: novo
Product name: Recombinant Human IL-2 Receptor Subunit γ, IL-2RG, CD132 (C-Fc-6His)
Quantity: 10 µg
Other quantities: 1 mg 1674€ 50 µg 303€ 500 µg 1115€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Human Cytokine receptor common subunit gamma is produced by our Mammalian expression system and the target gene encoding Leu23-Ala262 is expressed with a Fc
Molecular Weight: 29, 3 kD
UniProt number: P31785
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of phosphate buffered saline, 4 , Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD132 (C-Fc-6His), IL-2RG, IL-2 Receptor Subunit &gamma
Short name: CD132 (C-Fc-6His), IL-2RG, Recombinant IL-2 Receptor Subunit &gamma
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: CD132 (C-fragment c-6His), Interleukin-2RG, sapiens Interleukin-2 Receptor functionnal sequence &gamma, recombinant H
Alternative technique: rec
Identity: 6010
Gene: IL2RG | More about : IL2RG
Long gene name: interleukin 2 receptor subunit gamma
Synonyms gene: SCIDX1 IMD4 CIDX
Synonyms gene name: X-linked interleukin 2 receptor, gamma , severe combined immunodeficiency combined immunodeficiency
Synonyms: CD132
Locus: Xq13, 1
Discovery year: 1992-11-30
GenBank acession: D11086
Entrez gene record: 3561
Pubmed identfication: 1631559 7883965
Classification: CD molecules Fibronectin type III domain containing Interleukin receptors
Havana BLAST/BLAT: OTTHUMG00000021787
Locus Specific Databases: X-Linked Severe Combined Immuno deficiency SCID Mental Retardation database LRG_150

Related Products :

CB64 Recombinant Human IL-2 Receptor Subunit γ, IL-2RG, CD132 (C-Fc-6His) 50 µg 303 € novo human
CJ53 Recombinant Human IL-2 Receptor Subunit γ, IL-2RG, CD132 (C-Fc) 500 µg 1115 € novo human
MBS620042 Tubulin, gamma (TUBG, Tubulin gamma 1 Chain, TUBG1, Tubulin gamma 2 Chain, TUBG2, Gamma 1 Tubulin, Gamma 2 Tubulin, Gamma Tubulin 1, Gamma Tubulin 2, Gamma Tubulin Complex Component 1, GCP 1, GCP-1, MGC131994, Xgam) (Cy3) Antibody 100ul 696 € MBS Polyclonals_1 human
RP-0905H Recombinant Human IL2RG / CD132 Protein (Fc Tag) 20μg 456 € adv human
RP-0906H Recombinant Human IL2RG / CD132 Protein (His Tag) 50μg 624 € adv human
RP-1363M Recombinant Mouse IL2RG / CD132 Protein (His Tag) 50μg 659 € adv mouse
RP-2182R Recombinant Rat IL2RG / CD132 Protein (Fc Tag) 50μg 624 € adv rat
RP-2183R Recombinant Rat IL2RG / CD132 Protein (His Tag) 50μg 624 € adv rat
AR51889PU-N anti-CD132 / IL2RG (23-262, His-tag) Antibody 0,25 mg 1413 € acr human
AR51889PU-S anti-CD132 / IL2RG (23-262, His-tag) Antibody 50 Вµg 485 € acr human
BB-PA1616 anti-CD132 / IL2RG Antibody 0,1 mg 471 € acr human
AP52196PU-N anti-CD132 / IL2RG (Center) Antibody 0,4 ml 587 € acr human
AP52197PU-N anti-CD132 / IL2RG (N-term) Antibody 0,4 ml 587 € acr human
GENTAUR-58be3a206592a CD132 antibody (biotin) 0.025 miligrams 315 € MBS mono human
GENTAUR-58be3a20b4d0f CD132 antibody (biotin) 100ug 569 € MBS mono human
CK42 Recombinant Mouse Interferon γ Receptor 1, IFN-γ R1, CD119 (C-6His) 1 mg 1674 € novo human
MBS622524 GABA(B) Receptor 1, phosphorylated (Ser923) (Gamma-aminobutyric Acid (GABA) B Receptor 1, Gamma-aminobutyric Acid Type B Receptor Subunit 1, GABA B Receptor 1, GABABR1, GABA-B-R1, GABA-BR1, GABBR1-3, Gb1, GBR1) (Azide Free) Antibody 100ul 685 € MBS Polyclonals_1 human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
MBS611055 Heterochromatin Protein 1 gamma, (CBX3, chromobox homolog 3 (HP1 gamma homolog, Drosophila), HGNC:1553, HECH, HP1-GAMMA, HP1Hs-gamma, HP1 gamma homolog, chromobox homolog 3, chromobox homolog 3 (Drosophila HP1 gamma), heterochromatin protein HP1 gamma, he Antibody 100ug 591 € MBS Polyclonals_1 drosophila
MBS624490 GABA Receptor A, gamma 2 (Gamma-aminobutyric Acid Receptor Type A gamma Subunit, GABRA) Antibody 100ul 774 € MBS Polyclonals_1 human
MBS623718 GABA Receptor A, gamma 3 (Gamma-aminobutyric Acid Receptor Type A gamma 2 Subunit, GABRAg2) Antibody 200ul 558 € MBS Polyclonals_1 human
CM41 Recombinant Mouse Interferon γ, IFN-γ (C-6His) 50 µg 202 € novo human
CI70 Recombinant Human Interferon γ Receptor 1, IFNGR1 (C-6His) 500 µg 709 € novo human
MBS620273 SCNN1G (Sodium channel, nonvoltage-gated, type I, gamma, Amiloride-sensitive sodium channel subunit gamma, Epithelial Na(+) channel subunit gamma, Gamma-ENaC, Gamma-NaCH, Nonvoltage-gated sodium channel 1 subunit gamma, SCNEG) Antibody 100ul 641 € MBS Polyclonals_1 human
MBS624493 FCGR2B (CD32, Low Affinity Immunoglobulin gamma Fc Region Receptor II-b, IgG Fc Receptor II-b, CDw32, Fc-gamma RII-b, Fc-gamma-RIIb, FcRII-b, CD32, FCG2, IGFR2) Antibody 50ug 619 € MBS Polyclonals_1 human
MBS622505 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Ox-1-R, Ox1-R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) Antibody 100ug 652 € MBS Polyclonals_1 human
C632 Recombinant Human Nogo-66 Receptor, Reticulon 4 Receptor, NgR, RTN4R (C-6His) 1 mg 2283 € novo human
MBS619674 Estrogen-Related Receptor, gamma (ERR gamma, ERRg, ESRRG, DKFZP781L1617, Estrogen Receptor Related Protein 3, ERR3, FLJ16023, KIAA0832, Nuclear Receptor Subfamily 3 Group B Member 3, NR3B3) Antibody 50ug 928 € MBS Polyclonals_1 human
MBS615246 Retinoic Acid Receptor gamma2 (Retinoic Acid Receptor gamma Isoform 2, RAR gamma 2, RAR gamma2, RARgamma2, RARg2, Nuclear Receptor Subfamily 1 Group B Member 3, NR1B3, Retinoic Acid Receptor gamma, RAR gamma, RARg) Antibody 100ul 735 € MBS Polyclonals_1 human
CM42 Recombinant Mouse Nogo-66 Receptor, Reticulon 4 Receptor, NgR, RTN4R (C-6His) 10 µg 126 € novo mouse