| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human IL-20 Receptor alpha is produced by our Mammalian expression system and the target gene encoding Val30-Lys250 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
26, 3 kD |
| UniProt number: |
Q9UHF4 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4 , Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAKVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
&alpha, IL20RA (C-Fc), IL-20 Receptor Subunit &alpha |
| Short name: |
&alpha, IL20RA (C-Fc), Recombinant IL-20 Receptor Subunit &alpha |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
&alpha, a (C-fragment c), interleukin 20 receptor, sapiens Interleukin-20 Receptor functionnal sequence &alpha, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
IL20RA and IDBG-633655 and ENSBTAG00000015638 and 509038, IL20RA and IDBG-96985 and ENSG00000016402 and 53832, Il20ra and IDBG-136067 and ENSMUSG00000020007 and 237313, Plasma membranes, alpha, interleukin-20 binding, this GO :0005515 and protein binding and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0042015 and interleukin-20 binding and molecular function this GO :0045124 and regulation of bone resorption and biological process this GO :2001244 and positive regulation of intrinsic apoptotic signaling pathway and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0042015 : interleukin-20 binding, this GO :0042015 : interleukin-20 binding, interleukin 20 receptor |
| Identity: |
6003 |
| Gene: |
IL20RA |
More about : IL20RA |
| Long gene name: |
interleukin 20 receptor subunit alpha |
| Synonyms gene name: |
alpha interleukin 20 receptor alpha subunit , interleukin 20 receptor |
| Synonyms: |
ZCYTOR7 IL-20R1 |
| Locus: |
6q23, 3 |
| Discovery year: |
2000-05-23 |
| GenBank acession: |
AF184971 |
| Entrez gene record: |
53832 |
| Pubmed identfication: |
10875937 11163236 |
| RefSeq identity: |
NM_014432 |
| Classification: |
Interleukin receptors |
| Havana BLAST/BLAT: |
OTTHUMG00000015654 |