Recombinant Human SOD2, Mn-SOD (C-6His, Human Cells)

Contact us
Catalog number: CB01
Price: Ask price €
Supplier: genways bulk
Product name: Recombinant Human SOD2, Mn-SOD (C-6His, Human Cells)
Quantity: bulk
Other quantities: 10 µg 146€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human SOD2 is produced by our Mammalian expression system and the target gene encoding Lys25-Lys222 is expressed with a 6His tag at the C-terminus
Molecular Weight: 23, 24 kD
UniProt number: P04179
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0, pH8
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKKVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Cells), Mn-SOD (C-6His, SOD2
Short name: Cells), Mn-SOD (C-6His, Recombinant SOD2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: H, Mn-antioxidant enzyme (C-6His, mitochondrial, sapiens Cells), sapiens superoxide dismutase 2, recombinant H
Alternative technique: rec
Alternative to gene target: Cytoplasm, IPOB and MNSOD and MVCD6, SOD2 and IDBG-635443 and ENSBTAG00000006523 and 281496, SOD2 and IDBG-98553 and ENSG00000112096 and 100129518, Sod2 and IDBG-137806 and ENSMUSG00000006818 and 20656, metal ion binding, mitochondrial, this GO :0000302 and response to reactive oxygen species and biological process this GO :0000303 and response to superoxide and biological process this GO :0001306 and age-dependent response to oxidative stress and biological process this GO :0001315 and age-dependent response to reactive oxygen species and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001836 and release of cytochrome c from mitochondria and biological process this GO :0001889 and liver development and biological process this GO :0003032 and detection of oxygen and biological process this GO :0003069 and vasodilation by acetylcholine involved in regulation of systemic arterial blood pressure and biological process this GO :0003677 and DNA binding and molecular function this GO :0004784 and superoxide dismutase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005743 and mitochondrial inner membrane and cellular component this GO :0005759 and mitochondrial matrix and cellular component this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006749 and glutathione metabolic process and biological process this GO :0006801 and superoxide metabolic process and biological process this GO :0006979 and response to oxidative stress and biological process this GO :0007005 and mitochondrion organization and biological process this GO :0007507 and heart development and biological process this GO :0007568 and aging and biological process this GO :0007626 and locomotory behavior and biological process this GO :0008217 and regulation of blood pressure and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0008631 and intrinsic apoptotic signaling pathway in response to oxidative stress and biological process this GO :0008637 and apoptotic mitochondrial changes and biological process this GO :0009314 and response to radiation and biological process this GO :0009409 and response to cold and biological process this GO :0009791 and post-embryonic development and biological process this GO :0010042 and response to manganese ion and biological process this GO :0010043 and response to zinc ion and biological process this GO :0010269 and response to selenium ion and biological process this GO :0010332 and response to gamma radiation and biological process this GO :0014823 and response to activity and biological process this GO :0019430 and removal of superoxide radicals and biological process this GO :0019825 and oxygen binding and molecular function this GO :0022904 and respiratory electron transport chain and biological process this GO :0030097 and hemopoiesis and biological process this GO :0030145 and manganese ion binding and molecular function this GO :0031667 and response to nutrient levels and biological process this GO :0032364 and oxygen homeostasis and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0033591 and response to L-ascorbic acid and biological process this GO :0034021 and response to silicon dioxide and biological process this GO :0035900 and response to isolation stress and biological process this GO :0035902 and response to immobilization stress and biological process this GO :0042311 and vasodilation and biological process this GO :0042493 and response to drug and biological process this GO :0042542 and response to hydrogen peroxide and biological process this GO :0042554 and superoxide anion generation and biological process this GO :0042645 and mitochondrial nucleoid and cellular component this GO :0042743 and hydrogen peroxide metabolic process and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0045429 and positive regulation of nitric oxide biosynthetic process and biological process this GO :0045599 and negative regulation of fat cell differentiation and biological process this GO :0046686 and response to cadmium ion and biological process this GO :0046872 and metal ion binding and molecular function this GO :0048147 and negative regulation of fibroblast proliferation and biological process this GO :0048666 and neuron development and biological process this GO :0048678 and response to axon injury and biological process this GO :0048773 and erythrophore differentiation and biological process this GO :0050665 and hydrogen peroxide biosynthetic process and biological process this GO :0050790 and regulation of catalytic activity and biological process this GO :0051260 and protein homooli this GO merization and biological process this GO :0051289 and protein homotetramerization and biological process this GO :0051602 and response to electrical stimulus and biological process this GO :0051881 and regulation of mitochondrial membrane potential and biological process this GO :0055072 and iron ion homeostasis and biological process this GO :0055093 and response to hyperoxia and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071000 and response to magnetism and biological process this GO :0071361 and cellular response to ethanol and biological process this GO :1902176 and negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway and biological process, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0004784 : superoxide dismutase activity and also this GO :0005515 : protein binding and also this GO :0019825 : oxygen binding and also this GO :0030145 : manganese ion binding and also this GO :0042802 : identical protein binding and also this GO :0046872 : metal ion binding, this GO :0004784 : superoxide dismutase activity, this GO :0005515 : protein binding, this GO :0019825 : oxygen binding, this GO :0030145 : manganese ion binding, this GO :0042802 : identical protein binding, this GO :0046872 : metal ion binding, 6648, superoxide dismutase 2
Identity: 11180
Gene: SOD2 | More about : SOD2
Long gene name: superoxide dismutase 2
Synonyms gene name: mitochondrial , superoxide dismutase 2
Locus: 6q25, 3
Discovery year: 1986-01-01
GenBank acession: M36693
Entrez gene record: 6648
RefSeq identity: NM_000636
Havana BLAST/BLAT: OTTHUMG00000015940
Locus Specific Databases: ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database

Related Products :

CB01 Recombinant Human SOD2, Mn-SOD (C-6His, Human Cells) 500 µg 1613 € novo human
C677 Recombinant Human SOD2, Mn-SOD (N-6His) 500 µg 659 € novo human
AE17746HO-48 ELISA test for Horse Superoxide dismutase [Mn], mitochondrial (Mn-SOD/SOD2) 1x plate of 48 wells 402 € abebio horse
AE17746HO-96 Horse Superoxide dismutase [Mn], mitochondrial (Mn-SOD/SOD2) ELISA Kit 1x plate of 96 wells 671 € abebio horse
GENTAUR-58be254011c8a anti-CD45 RA B-cells, T-cells, NK-cells 1000ug 1028 € MBS mono human
GENTAUR-58be25408a38d anti-CD45 RA B-cells, T-cells, NK-cells 100ug 304 € MBS mono human
MBS620748 NFAT3 (NF-AT3, Cytoplasmic Nuclear Factor of Activated T cells 4, Nuclear Factor of Activated T cells Cytoplasmic 4, Nuclear Factor of Activated T cells Cytoplasmic Calcineurin Dependent 4, NF-ATc4, NFATc4, Nuclear Factor of Activated T cells, T cell Tran Antibody 100ug 509 € MBS Polyclonals_1 human
MBS619705 Superoxide Dismutase, Cu,Zn (Superoxide Dismutase Cu/Zn, SOD Cu,Zn, Cu/Zn SOD, Amyotrophic Lateral Sclerosis 1, ALS1, ALS, Homodimer, Indophenoloxidase A, IPOA, Superoxide Dismutase 1, Superoxide Dismutase 1 Soluble, SOD1, SOD-1, Superoxide Dismutase Cyst Antibody 100ul 652 € MBS Polyclonals_1 human
MBS621026 Superoxide Dismutase, Cu,Zn (Superoxide Dismutase Cu/Zn, SOD Cu,Zn, Cu/Zn SOD, CuZnSOD, SODC, Amyotrophic Lateral Sclerosis 1, ALS1, ALS, Ipo1, Ipo-1, Superoxide Dismutase 1 (Soluble), SOD1, SOD-1) Antibody 100ul 652 € MBS Polyclonals_1 human
MBS620593 Superoxide Dismutase, Mn (Manganese Superoxide Dismutase, Manganese SOD, Mn SOD, MnSOD, IPO-B, Superoxide Dismutase [Mn] Mitochondrial Precursor, Superoxide Dismutase 2 Mitochondrial, SOD 2, SOD2, SOD-2) Antibody 0.05 ml 669 € MBS Polyclonals_1 human
CE19 Recombinant Human Superoxide Dismutase [Cu-Zn], SOD1, Cu-Zn SOD (N-6His) 1 mg 2283 € novo human
C846 Recombinant Human Galectin-3, LGALS3 (C-6His, Human Cells) 50 µg 303 € novo human
CC79 Recombinant Human GM-CSF, CSF2 (C-6His, Human Cells) 10 µg 146 € novo human
CD98 Recombinant Human NGAL, Lipocalin-2, LCN2 (C-6His, Human Cells) 500 µg 1613 € novo human
CA38 Recombinant Human Linker for Activation of T-Cells Family Member 2, LAT2 (C-6His) 1 mg 2283 € novo human
CA63 Recombinant Human Natural Killer Cells Antigen CD94, CD94 (N-6His) 500 µg 1613 € novo human
CI89 Recombinant Mouse Adiponectin, Acrp30, AdipoQ (C-6His, Human Cells) 500 µg 1613 € novo human
CM92 Recombinant Mouse Triggering Receptor Expressed on Myeloid Cells 2b, TREM-2b (C-6His) 50 µg 303 € novo mouse
AM39050SU-N anti-B cells and T cells (Pan) Antibody 1 ml 413 € acr human
GENTAUR-58be25513e8e3 anti-CD38 Hematopoietic precursors, thymocytes, activated T-cells, plasma cells 100ug 304 € MBS mono human
GENTAUR-58be2551a1100 anti-CD38 Hematopoietic precursors, thymocytes, activated T-cells, plasma cells 1000ug 1028 € MBS mono human
SM1210 anti-Dendritic cells + B-cells Antibody 0,2 mg 746 € acr human
SM064 anti-Dendritic cells + Interdigitating cells Antibody 2 ml 616 € acr human
SM064P anti-Dendritic cells + Interdigitating cells Antibody 0,2 mg 717 € acr human
GWB-20A27F CD7 (T cells and NK cells), antibody 1 x 1 vial 544 € genways human
YSRTMCA83A Mouse Ly 6C.2, differentiates activated B-Cells from virgin or memory cells, Clone: H9/25, Mouse Monoclonal antibody-; WB 500ul Ask price € accurate-monoclonals mouse
MBS619460 SART1 (Squamous Cell Carcinoma Antigen Recognised by T Cells, Squamous Cell Carcinoma Antigen Recognized by T Cells 1, SART-1, ARA1, HOMS1, hSART-1, hSnu66, IgE Autoantigen, MGC2038, SART1-259, SART1259 Protein, SART1 (800) Protein, Snu66, U4/U6.U5 Tri sn Antibody 100ug 735 € MBS Polyclonals_1 human
MBS619550 XRCC3 (X Ray Repair Complementing Defective Repair in Chinese Hamster Cells 3, X-ray Repair Complementing Defective Repair in Chinese Hamster Cells 3, X Ray Repair Cross Complementing Protein 3, X-ray Repair Cross-complementing Protein 3, DNA Repair Prote 50ug 713 € MBS Polyclonals_1 hamster
MBS623188 XRCC6 (X Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6, X-ray Repair Complementing Defective Repair in Chinese Hamster Cells 6, 70kD Subunit of Ku Antigen, ATP Dependent DNA Helicase 2 Subunit 1, ATP-dependent DNA Helicase II 70kD S Antibody 100ug 591 € MBS Polyclonals_1 hamster
GWB-P1526E SOD2, 25-222aa, Recombinant Protein bulk Ask price € genways bulk human