| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Superoxide Dismutase [Mn] Mitochondrial is produced by our E, coli expression system and the target gene encoding Lys25-Lys222 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
23, 7 kD |
| UniProt number: |
P04179 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
100 mM sodium chloride, 2 um filtered solution of 20 mM Tris, 50% glycerol, Supplied as a 0, pH 8 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MHHHHHHDDDDKKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
Mn-SOD (N-6His), SOD2 |
| Short name: |
Mn-SOD (N-6His), Recombinant SOD2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
Mn-antioxidant enzyme (N-6His), mitochondrial, sapiens superoxide dismutase 2, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Cytoplasm, IPOB and MNSOD and MVCD6, SOD2 and IDBG-635443 and ENSBTAG00000006523 and 281496, SOD2 and IDBG-98553 and ENSG00000112096 and 100129518, Sod2 and IDBG-137806 and ENSMUSG00000006818 and 20656, metal ion binding, mitochondrial, this GO :0000302 and response to reactive oxygen species and biological process this GO :0000303 and response to superoxide and biological process this GO :0001306 and age-dependent response to oxidative stress and biological process this GO :0001315 and age-dependent response to reactive oxygen species and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001836 and release of cytochrome c from mitochondria and biological process this GO :0001889 and liver development and biological process this GO :0003032 and detection of oxygen and biological process this GO :0003069 and vasodilation by acetylcholine involved in regulation of systemic arterial blood pressure and biological process this GO :0003677 and DNA binding and molecular function this GO :0004784 and superoxide dismutase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005743 and mitochondrial inner membrane and cellular component this GO :0005759 and mitochondrial matrix and cellular component this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006749 and glutathione metabolic process and biological process this GO :0006801 and superoxide metabolic process and biological process this GO :0006979 and response to oxidative stress and biological process this GO :0007005 and mitochondrion organization and biological process this GO :0007507 and heart development and biological process this GO :0007568 and aging and biological process this GO :0007626 and locomotory behavior and biological process this GO :0008217 and regulation of blood pressure and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0008631 and intrinsic apoptotic signaling pathway in response to oxidative stress and biological process this GO :0008637 and apoptotic mitochondrial changes and biological process this GO :0009314 and response to radiation and biological process this GO :0009409 and response to cold and biological process this GO :0009791 and post-embryonic development and biological process this GO :0010042 and response to manganese ion and biological process this GO :0010043 and response to zinc ion and biological process this GO :0010269 and response to selenium ion and biological process this GO :0010332 and response to gamma radiation and biological process this GO :0014823 and response to activity and biological process this GO :0019430 and removal of superoxide radicals and biological process this GO :0019825 and oxygen binding and molecular function this GO :0022904 and respiratory electron transport chain and biological process this GO :0030097 and hemopoiesis and biological process this GO :0030145 and manganese ion binding and molecular function this GO :0031667 and response to nutrient levels and biological process this GO :0032364 and oxygen homeostasis and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0033591 and response to L-ascorbic acid and biological process this GO :0034021 and response to silicon dioxide and biological process this GO :0035900 and response to isolation stress and biological process this GO :0035902 and response to immobilization stress and biological process this GO :0042311 and vasodilation and biological process this GO :0042493 and response to drug and biological process this GO :0042542 and response to hydrogen peroxide and biological process this GO :0042554 and superoxide anion generation and biological process this GO :0042645 and mitochondrial nucleoid and cellular component this GO :0042743 and hydrogen peroxide metabolic process and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0045429 and positive regulation of nitric oxide biosynthetic process and biological process this GO :0045599 and negative regulation of fat cell differentiation and biological process this GO :0046686 and response to cadmium ion and biological process this GO :0046872 and metal ion binding and molecular function this GO :0048147 and negative regulation of fibroblast proliferation and biological process this GO :0048666 and neuron development and biological process this GO :0048678 and response to axon injury and biological process this GO :0048773 and erythrophore differentiation and biological process this GO :0050665 and hydrogen peroxide biosynthetic process and biological process this GO :0050790 and regulation of catalytic activity and biological process this GO :0051260 and protein homooli this GO merization and biological process this GO :0051289 and protein homotetramerization and biological process this GO :0051602 and response to electrical stimulus and biological process this GO :0051881 and regulation of mitochondrial membrane potential and biological process this GO :0055072 and iron ion homeostasis and biological process this GO :0055093 and response to hyperoxia and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071000 and response to magnetism and biological process this GO :0071361 and cellular response to ethanol and biological process this GO :1902176 and negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway and biological process, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0004784 : superoxide dismutase activity and also this GO :0005515 : protein binding and also this GO :0019825 : oxygen binding and also this GO :0030145 : manganese ion binding and also this GO :0042802 : identical protein binding and also this GO :0046872 : metal ion binding, this GO :0004784 : superoxide dismutase activity, this GO :0005515 : protein binding, this GO :0019825 : oxygen binding, this GO :0030145 : manganese ion binding, this GO :0042802 : identical protein binding, this GO :0046872 : metal ion binding, 6648, superoxide dismutase 2 |
| Identity: |
11180 |
| Gene: |
SOD2 |
More about : SOD2 |
| Long gene name: |
superoxide dismutase 2 |
| Synonyms gene name: |
mitochondrial , superoxide dismutase 2 |
| Locus: |
6q25, 3 |
| Discovery year: |
1986-01-01 |
| GenBank acession: |
M36693 |
| Entrez gene record: |
6648 |
| RefSeq identity: |
NM_000636 |
| Havana BLAST/BLAT: |
OTTHUMG00000015940 |
| Locus Specific Databases: |
ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database |