| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Poliovirus Receptor is produced by our Mammalian expression system and the target gene encoding Ala23-Leu131 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
1 kD, 12 |
| UniProt number: |
Q86YL7 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4 , Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
ASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
Aggrus (C-Fc), PDPN, Podoplanin |
| Short name: |
Aggrus (C-Fc), PDPN, Recombinant Podoplanin |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
Aggrus (C-fragment c), podoplanin, sapiens Podoplanin, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
AGGRUS and GP36 and Gp38 and GP40 and HT1A-1 and OTS8 and PA2, BOVAGGRUS and IDBG-636063 and ENSBTAG00000001788 and 509732, Cell surfaces, PDPN and IDBG-90582 and ENSG00000162493 and 10630, Pdpn and IDBG-202630 and ENSMUSG00000028583 and 14726, this GO :0000902 and cell morphogenesis and biological process this GO :0001726 and ruffle and cellular component this GO :0001946 and lymphangiogenesis and biological process this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006693 and prostaglandin metabolic process and biological process this GO :0006928 and cellular component movement and biological process this GO :0006954 and inflammatory response and biological process this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007399 and nervous system development and biological process this GO :0008283 and cell proliferation and biological process this GO :0008360 and regulation of cell shape and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0010572 and positive regulation of platelet activation and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016324 and apical plasma membrane and cellular component this GO :0016337 and single organismal cell-cell adhesion and biological process this GO :0030027 and lamellipodium and cellular component this GO :0030175 and filopodium and cellular component this GO :0030324 and lung development and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0031258 and lamellipodium membrane and cellular component this GO :0031527 and filopodium membrane and cellular component this GO :0031528 and microvillus membrane and cellular component this GO :0032587 and ruffle membrane and cellular component this GO :0035239 and tube morphogenesis and biological process this GO :0048286 and lung alveolus development and biological process this GO :0051272 and positive regulation of cellular component movement and biological process this GO :0055093 and response to hyperoxia and biological process this GO :2000045 and regulation of G1/S transition of mitotic cell cycle and biological process, 26 and T1A and T1A-2 and T1A2 and TI1A, podoplanin |
| Identity: |
29602 |
| Gene: |
PDPN |
More about : PDPN |
| Long gene name: |
podoplanin |
| Synonyms: |
T1A-2 Gp38 aggrus GP40 PA2, 26 |
| Synonyms name: |
lung type I cell membrane associated glycoprotein |
| Locus: |
1p36, 21 |
| Discovery year: |
2005-07-08 |
| GenBank acession: |
AB127958 AY194238 |
| Entrez gene record: |
10630 |
| Pubmed identfication: |
10393083 9651190 |
| RefSeq identity: |
NM_006474 |
| Havana BLAST/BLAT: |
OTTHUMG00000007912 |