| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Podoplanin is produced by our Mammalian expression system and the target gene encoding Ala23-Thr131 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
12, 16 kD |
| UniProt number: |
Q86YL7 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
ASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
Aggrus (C-6His), PDPN, Podoplanin |
| Short name: |
Aggrus (C-6His), PDPN, Recombinant Podoplanin |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
Aggrus (C-6His), podoplanin, sapiens Podoplanin, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
AGGRUS and GP36 and Gp38 and GP40 and HT1A-1 and OTS8 and PA2, BOVAGGRUS and IDBG-636063 and ENSBTAG00000001788 and 509732, Cell surfaces, PDPN and IDBG-90582 and ENSG00000162493 and 10630, Pdpn and IDBG-202630 and ENSMUSG00000028583 and 14726, this GO :0000902 and cell morphogenesis and biological process this GO :0001726 and ruffle and cellular component this GO :0001946 and lymphangiogenesis and biological process this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006693 and prostaglandin metabolic process and biological process this GO :0006928 and cellular component movement and biological process this GO :0006954 and inflammatory response and biological process this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007399 and nervous system development and biological process this GO :0008283 and cell proliferation and biological process this GO :0008360 and regulation of cell shape and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0010572 and positive regulation of platelet activation and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016324 and apical plasma membrane and cellular component this GO :0016337 and single organismal cell-cell adhesion and biological process this GO :0030027 and lamellipodium and cellular component this GO :0030175 and filopodium and cellular component this GO :0030324 and lung development and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0031258 and lamellipodium membrane and cellular component this GO :0031527 and filopodium membrane and cellular component this GO :0031528 and microvillus membrane and cellular component this GO :0032587 and ruffle membrane and cellular component this GO :0035239 and tube morphogenesis and biological process this GO :0048286 and lung alveolus development and biological process this GO :0051272 and positive regulation of cellular component movement and biological process this GO :0055093 and response to hyperoxia and biological process this GO :2000045 and regulation of G1/S transition of mitotic cell cycle and biological process, 26 and T1A and T1A-2 and T1A2 and TI1A, podoplanin |
| Identity: |
29602 |
| Gene: |
PDPN |
More about : PDPN |
| Long gene name: |
podoplanin |
| Synonyms: |
T1A-2 Gp38 aggrus GP40 PA2, 26 |
| Synonyms name: |
lung type I cell membrane associated glycoprotein |
| Locus: |
1p36, 21 |
| Discovery year: |
2005-07-08 |
| GenBank acession: |
AB127958 AY194238 |
| Entrez gene record: |
10630 |
| Pubmed identfication: |
10393083 9651190 |
| RefSeq identity: |
NM_006474 |
| Havana BLAST/BLAT: |
OTTHUMG00000007912 |