Recombinant Human Leukocyte Ig-Like Receptor A2, LILRA2, ILT1, CD85h (C-6His)

Contact us
Catalog number: CA47
Price: 833 €
Supplier: abbex
Product name: Recombinant Human Leukocyte Ig-Like Receptor A2, LILRA2, ILT1, CD85h (C-6His)
Quantity: 100 μg
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human LILRA2 is produced by our Mammalian expression system and the target gene encoding Gly24-Ser420 is expressed with a 6His tag at the C-terminus
Molecular Weight: 44, 8 kD
UniProt number: Q8N149
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSASVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD85h (C-6His), ILT1, LILRA2, Leukocyte Ig-Like Receptor A2
Short name: CD85h (C-6His), ILT1, LILRA2, Recombinant Leukocyte Ig-Like Receptor A2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD85h (C-6His), ILT1, leukocyte immunoglobulin-like receptor, member 2, sapiens Leukocyte Ig-Like Receptor A2, subfamily A (including TM domain), recombinant H
Alternative technique: rec
Alternative to gene target: CD85H and ILT1 and LIR-7 and LIR7, LILRA2 and IDBG-409454 and ENSG00000239998 and 11027, Plasma membranes, member 2, protein binding, subfamily A (with TM domain), this GO :0002376 and immune system process and biological process this GO :0003823 and antigen binding and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0006952 and defense response and biological process this GO :0007165 and signal transduction and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0045087 and innate immune response and biological process, this GO :0003823 : antigen binding, this GO :0003823 : antigen binding and also this GO :0004872 : receptor activity and also this GO :0005515 : protein binding, this GO :0004872 : receptor activity, this GO :0005515 : protein binding, leukocyte immunoglobulin-like receptor
Identity: 6603
Gene: LILRA2 | More about : LILRA2
Long gene name: leukocyte immunoglobulin like receptor A2
Synonyms gene name: leukocyte immunoglobulin-like receptor, member 2 , subfamily A (with TM domain)
Synonyms: LIR-7 ILT1 CD85h LIR7
Synonyms name: leucocyte Ig-like receptor A2
Locus: 19q13, 4
Discovery year: 2000-01-11
GenBank acession: U82275
Pubmed identfication: 9079806 9548455
Classification: Activating leukocyte immunoglobulin like receptors CD molecules
Havana BLAST/BLAT: OTTHUMG00000065703

Related Products :

CA47 Recombinant Human Leukocyte Ig-Like Receptor A2, LILRA2, ILT1, CD85h (C-6His) 50 µg 369 € novo human
C16462-1 anti-CD85h / LILRA2 Antibody 50 Вµg 347 € acr human
C16462-2 anti-CD85h / LILRA2 Antibody 0,1 mg 500 € acr human
AP52479PU-N anti-CD85h / LILRA2 (Center) Antibody 0,4 ml 587 € acr human
GENTAUR-58bdd4f4ceba4 Anti- Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 2 (LILRA2) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdd4f52bb5b Anti- Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 2 (LILRA2) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdd551ecd7d Anti- Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 2 (LILRA2) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd9f2ac67c Anti- Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 2 (LILRA2) Antibody 100ug 542 € MBS Polyclonals human
MBS620347 SLP-76, NT (SH2 Domain Containing Leukocyte Protein 76 kD, SH2 Domain-containing Leukocyte Protein of 76kD, SH2 Domain Containing Leukocyte Protein of 76kDa, SLP76, SLP76 Tyrosine Phosphoprotein, SLP-76 Tyrosine Phosphoprotein, 76kD Tyrosine Phosphoprotei 100ug 763 € MBS Polyclonals_1 human
CC83 Recombinant Human Leukocyte Ig-Like Receptor A3, LILRA3, ILT6, CD85e (C-6His) 10 µg 146 € novo human
C484 Recombinant Human Leukocyte Ig-Like Receptor B1, LILRB1, ILT2, CD85j (C-6His) 500 µg 1613 € novo human
C485 Recombinant Human Leukocyte Ig-Like Receptor B2, LILRB2, ILT4, CD85d (C-6His) 10 µg 121 € novo human
C574 Recombinant Human Leukocyte Mono Ig-Like Receptor 1, LMIR1, CD300a (C-6His) 50 µg 303 € novo human
CD41 Recombinant Human Leukocyte Mono Ig-Like Receptor 1, LMIR1, CD300a (C-Fc-6His) 10 µg 146 € novo human
C443 Recombinant Human Leukocyte Mono Ig-Like Receptor 2, LMIR2, CD300C (C-6His) 50 µg 273 € novo human
CJ01 Recombinant Human Leukocyte Elastase Inhibitor, Serpin B1, SERPINB1 (C-6His) 1 mg 2283 € novo human
RP-879 Recombinant (E.Coli) Human Leukocyte-Associated Ig-Like Receptor 1 5 μg 188 € adi human
CD16 Recombinant Human Leukocyte Mono Ig-Like Receptor 2, LMIR2, CD300C (C-Fc) 50 µg 303 € novo human
GWB-ASE686 Human LILRA2 Antibody bulk Ask price € genways bulk human
LV205337 LILRA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV205338 LILRA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV205339 LILRA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV205340 LILRA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV205342 LILRA2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV205341 LILRA2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
MBS615516 APJ Receptor (APLNR, Apelin receptor, AGTRL1, angiotensin II receptor-like 1, Angiotensin receptor-like 1, Apelin receptor, APJ, APJR, FLJ90771, G-protein coupled receptor APJ, HG11, MGC45246) Antibody 0.05 ml 536 € MBS Polyclonals_1 human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
abx261724 Anti-Leukocyte-Associated Ig-Like Receptor 1 Protein (Recombinant) 20 µg 340 € abbex human
abx261907 Anti-Leukocyte-Associated Ig-Like Receptor 2 Protein (Recombinant) 1 mg 4675 € abbex human
abx168118 Anti-Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 2 Protein (Recombinant) 100 μg 833 € abbex human