| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human LILRA2 is produced by our Mammalian expression system and the target gene encoding Gly24-Ser420 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
44, 8 kD |
| UniProt number: |
Q8N149 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSASVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD85h (C-6His), ILT1, LILRA2, Leukocyte Ig-Like Receptor A2 |
| Short name: |
CD85h (C-6His), ILT1, LILRA2, Recombinant Leukocyte Ig-Like Receptor A2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD85h (C-6His), ILT1, leukocyte immunoglobulin-like receptor, member 2, sapiens Leukocyte Ig-Like Receptor A2, subfamily A (including TM domain), recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD85H and ILT1 and LIR-7 and LIR7, LILRA2 and IDBG-409454 and ENSG00000239998 and 11027, Plasma membranes, member 2, protein binding, subfamily A (with TM domain), this GO :0002376 and immune system process and biological process this GO :0003823 and antigen binding and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0006952 and defense response and biological process this GO :0007165 and signal transduction and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0045087 and innate immune response and biological process, this GO :0003823 : antigen binding, this GO :0003823 : antigen binding and also this GO :0004872 : receptor activity and also this GO :0005515 : protein binding, this GO :0004872 : receptor activity, this GO :0005515 : protein binding, leukocyte immunoglobulin-like receptor |
| Identity: |
6603 |
| Gene: |
LILRA2 |
More about : LILRA2 |
| Long gene name: |
leukocyte immunoglobulin like receptor A2 |
| Synonyms gene name: |
leukocyte immunoglobulin-like receptor, member 2 , subfamily A (with TM domain) |
| Synonyms: |
LIR-7 ILT1 CD85h LIR7 |
| Synonyms name: |
leucocyte Ig-like receptor A2 |
| Locus: |
19q13, 4 |
| Discovery year: |
2000-01-11 |
| GenBank acession: |
U82275 |
| Pubmed identfication: |
9079806 9548455 |
| Classification: |
Activating leukocyte immunoglobulin like receptors CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000065703 |