| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human LMIR2 is produced by our Mammalian expression system and the target gene encoding Gly21-Arg183 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
18, 89 kD |
| UniProt number: |
Q08708 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD300C (C-6His), LMIR2, Leukocyte Mono Ig-Like Receptor 2 |
| Short name: |
CD300C (C-6His), LMIR2, Recombinant Leukocyte Mono Ig-Like Receptor 2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD300c molecule (C-6His), LMIR2, sapiens Leukocyte Mono Ig-Like Receptor 2, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD300C and IDBG-67336 and ENSG00000167850 and 10871, CLM-6 and CMRF-35 and CMRF-35A and CMRF35 and CMRF35-A1 and CMRF35A and CMRF35A1 and IGSF16 and LIR, Plasma membranes, protein binding, this GO :0002376 and immune system process and biological process this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006968 and cellular defense response and biological process this GO :0007165 and signal transduction and biological process, this GO :0004888 : transmembrane signaling receptor activity, this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, CD300c molecule |
| Identity: |
19320 |
| Gene: |
CD300C |
More about : CD300C |
| Long gene name: |
CD300c molecule |
| Synonyms gene name: |
CD300c antigen |
| Synonyms: |
CMRF35 LIR CMRF-35A CMRF35A IGSF16 |
| Locus: |
17q25, 1 |
| Discovery year: |
2005-02-08 |
| GenBank acession: |
BC022279 |
| Entrez gene record: |
10871 |
| Pubmed identfication: |
1349532 10746781 |
| RefSeq identity: |
NM_006678 |
| Classification: |
CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000067608 |