Recombinant Human Elafin, Trappin-2 (C-6His)

Contact us
Catalog number: CA39
Price: 2283 €
Supplier: novo
Product name: Recombinant Human Elafin, Trappin-2 (C-6His)
Quantity: 1 mg
Other quantities: 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Elafin is produced by our Mammalian expression system and the target gene encoding Ala23-Gln117 is expressed with a 6His tag at the C-terminus
Molecular Weight: 11 kD
UniProt number: P19957
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM TrisHCl, 5, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Trappin-2 (C-6His), Elafin
Short name: Trappin-2 (C-6His), Recombinant Elafin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: Trappin-2 (C-6His), sapiens Elafin, recombinant H
Alternative technique: rec

Related Products :

CA39 Recombinant Human Elafin, Trappin-2 (C-6His) 10 µg 202 € novo human
101-M686 Anti-Human Trappin-2 100ug 336 € Reliatech antibodies human
RP-1219H Recombinant Human PI3 / Elafin / WFDC14 Protein (His Tag) 10μg 624 € adv human
GENTAUR-58be2eaf88f6d Elafin, Human, mAb TRAB2F 100ug 647 € MBS mono human
GENTAUR-58be2eaf294ef Elafin, Human, mAb TRAB2F Antibody 100ug 647 € MBS mono human
GENTAUR-58be2e0711d97 Elafin, Human, mAb TRAB2O 100ug 647 € MBS mono human
GENTAUR-58be2e076a34d Elafin, Human, mAb TRAB2O Antibody 100ug 647 € MBS mono human
MBS584510 Elafin, Human, pAb Antibody 1 mililiter 685 € MBS Polyclonals_1 human
AR51068PU-N anti-Elafin / PI3 (23-117, His-tag) Antibody 0,25 mg 1109 € acr human
AR51068PU-S anti-Elafin / PI3 (23-117, His-tag) Antibody 50 Вµg 485 € acr human
AR51935PU-N anti-Elafin / PI3 (23-117, His-tag) Antibody 0,25 mg 1834 € acr human
AR51935PU-S anti-Elafin / PI3 (23-117, His-tag) Antibody 50 Вµg 587 € acr human
AM26267PU-N anti-Elafin / PI3 Antibody 0,1 mg 761 € acr human
AP26406SU-N anti-Elafin / PI3 Antibody 1 ml 703 € acr human
AM26266PU-N anti-Elafin / PI3 (C-term) Antibody 0,1 mg 761 € acr human
R32376 Elafin Antibody 0.1mg 406 € NJS poly human
C846 Recombinant Human Galectin-3, LGALS3 (C-6His, Human Cells) 50 µg 303 € novo human
CC79 Recombinant Human GM-CSF, CSF2 (C-6His, Human Cells) 10 µg 146 € novo human
CD98 Recombinant Human NGAL, Lipocalin-2, LCN2 (C-6His, Human Cells) 500 µg 1613 € novo human
CB01 Recombinant Human SOD2, Mn-SOD (C-6His, Human Cells) 500 µg 1613 € novo human
C848 Recombinant Human 15-PGDH, HPGD (C-6His) 500 µg 1613 € novo human
CI63 Recombinant Human 17β-Hydroxysteroid Dehydrogenase 10, HSD17B10 (C-6His) 1 mg 2486 € novo human
CH76 Recombinant Human 2'-5'-Oligoadenylate Synthase-Like Protein, OASLOASL (C-6His) 10 µg 202 € novo human
CE05 Recombinant Human 3-Hydroxybutyrate Dehydrogenase Type 2, BDH2, DHRS6 (N-6His) 50 µg 496 € novo human
CH04 Recombinant Human 4-1BB Ligand, 4-1BBL, TNFSF9, CD137L (C-6His) 500 µg 1613 € novo human
CP05 Recombinant Human 4-1BB, TNFRSF9, CD137 (C-6His) 1 mg 1014 € novo human
CJ38 Recombinant Human 4-1BB, TNFRSF9, CD137 (C-Fc-6His) 500 µg 709 € novo human
CE50 Recombinant Human 4-Hydroxyphenylpyruvate Dioxygenase, 4HPPD, HPPDase (N-6His) 10 µg 202 € novo human
CH74 Recombinant Human 40S Ribosomal Protein S7, RPS7 (C-6His) 500 µg 1613 € novo human
C591 Recombinant Human 5-Demethoxyubiquinone Hydroxylase, Mitochondrial, COQ7 (C-6His) 1 mg 2283 € novo human