Recombinant Human Sialidase-1, NEU-1 (C-6His)

Catalog number:	C999 Buy Now
Price:	2580 €
Supplier:	MBS Recombinant Proteins
Product name:	Recombinant Human Sialidase-1, NEU-1 (C-6His)
Quantity:	100ug
Other quantities:	10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:	human gene neu neuralized drosophila alternative details

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Sialidase-1 is produced by our Mammalian expression system and the target gene encoding Glu48-Leu415 is expressed with a 6His tag at the C-terminus
Molecular Weight:	27 kD, 41
UniProt number:	Q99519
State of the product:	Liquid
Shipping conditions:	Dry Ice/ice packs
Formulation:	150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7
Storage recommendations:	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution:	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	ENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTLVDHHHHHH
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	NEU-1 (C-6His), Sialidase-1
Short name:	NEU-1 (C-6His), Recombinant Sialidase-1
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	NEU-1 (C-6His), sapiens Sialidase-1, recombinant H
Alternative technique:	rec
Identity:	7761
Gene:	NEURL1 | More about : NEURL1
Long gene name:	neuralized E3 ubiquitin protein ligase 1
Synonyms gene:	NEURL
Synonyms gene name:	neuralized (Drosophila)-like neuralized-like (Drosophila) neuralized homolog (Drosophila)
Synonyms:	h-neu RNF67 neu-1
Locus:	10q24, 33
Discovery year:	1999-02-09
GenBank acession:	U87864
Entrez gene record:	9148
Pubmed identfication:	9519875 20847082
Classification:	Ring finger proteins
Havana BLAST/BLAT:	OTTHUMG00000018995

• #human
• #gene
• #neu
• #neuralized
• #drosophila
• #alternative
• #details