Recombinant Human Sialidase-1, NEU-1 (C-6His)

Contact us
Catalog number: C999
Price: 2580 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Sialidase-1, NEU-1 (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Sialidase-1 is produced by our Mammalian expression system and the target gene encoding Glu48-Leu415 is expressed with a 6His tag at the C-terminus
Molecular Weight: 27 kD, 41
UniProt number: Q99519
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTLVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: NEU-1 (C-6His), Sialidase-1
Short name: NEU-1 (C-6His), Recombinant Sialidase-1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: NEU-1 (C-6His), sapiens Sialidase-1, recombinant H
Alternative technique: rec
Identity: 7761
Gene: NEURL1 | More about : NEURL1
Long gene name: neuralized E3 ubiquitin protein ligase 1
Synonyms gene: NEURL
Synonyms gene name: neuralized (Drosophila)-like neuralized-like (Drosophila) neuralized homolog (Drosophila)
Synonyms: h-neu RNF67 neu-1
Locus: 10q24, 33
Discovery year: 1999-02-09
GenBank acession: U87864
Entrez gene record: 9148
Pubmed identfication: 9519875 20847082
Classification: Ring finger proteins
Havana BLAST/BLAT: OTTHUMG00000018995

Related Products :

C999 Recombinant Human Sialidase-1, NEU-1 (C-6His) 1 mg 2283 € novo human
GWB-766066 Sialidase 1 (lysosomal Sialidase) (NEU1) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody 1 tube 602 € genways human
GENTAUR-58bd58c87067a human Sialidase-3 protein 1 mg 1475 € MBS Recombinant Proteins human
GENTAUR-58bd58c8b99d1 human Sialidase-3 protein 0.05 mg 265 € MBS Recombinant Proteins human
GENTAUR-58bd58c8ee795 human Sialidase-3 protein 0.2 mg 564 € MBS Recombinant Proteins human
GENTAUR-58bd58c93a100 human Sialidase-3 protein 0.5 mg 951 € MBS Recombinant Proteins human
MBS221018 Anti-BACTERIAL SIALIDASE Antibody 1 mililiter 486 € MBS Polyclonals_1 human
abx571264 Anti-Rat Sialidase 2, Cytosolic (SIAL2) ELISA Kit 96 tests 833 € abbex rat
AR50509PU-N anti-Sialidase 1 (48-415, His-tag) Antibody 0,5 mg 1413 € acr human
AR50509PU-S anti-Sialidase 1 (48-415, His-tag) Antibody 0,1 mg 587 € acr human
AM26497AF-N anti-Sialidase-3 Antibody 0,1 mg 572 € acr human
AP52856PU-N anti-Sialidase-4 (C-term) Antibody 0,4 ml 587 € acr human
GWB-9CC345 Bacterial Sialidase antibody 1 vial 585 € genways human
GENTAUR-58ba639fbfe7b Mouse Sialidase-1 (Neu1) 100ug 2045 € MBS Recombinant Proteins mouse
GENTAUR-58ba63a051094 Mouse Sialidase-1 (Neu1) 1000ug 2045 € MBS Recombinant Proteins mouse
GENTAUR-58ba63a10061f Mouse Sialidase-1 (Neu1) 100ug 2558 € MBS Recombinant Proteins mouse
GENTAUR-58ba63a168cda Mouse Sialidase-1 (Neu1) 1000ug 2558 € MBS Recombinant Proteins mouse
DL-SIAL2-Ra Rat Sialidase 2, Cytosolic SIAL2 ELISA Kit 96T 962 € DL elisas rat
GENTAUR-58b8f9c06a591 Salmonella typhimurium Sialidase (nanH) 100ug 2078 € MBS Recombinant Proteins salmonella
GENTAUR-58b8f9c0c97b4 Salmonella typhimurium Sialidase (nanH) 1000ug 2078 € MBS Recombinant Proteins salmonella
GENTAUR-58b8f9c13fe9a Salmonella typhimurium Sialidase (nanH) 100ug 2592 € MBS Recombinant Proteins salmonella
GENTAUR-58b8f9c19ca16 Salmonella typhimurium Sialidase (nanH) 1000ug 2592 € MBS Recombinant Proteins salmonella
GENTAUR-58b9f7cf3a6ed Salmonella typhimurium Sialidase (nanH) 100ug 2078 € MBS Recombinant Proteins salmonella
GENTAUR-58b9f7cfd1bd7 Salmonella typhimurium Sialidase (nanH) 1000ug 2078 € MBS Recombinant Proteins salmonella
GENTAUR-58b9f7d077d3d Salmonella typhimurium Sialidase (nanH) 100ug 2592 € MBS Recombinant Proteins salmonella
GENTAUR-58b9f7d10369f Salmonella typhimurium Sialidase (nanH) 1000ug 2592 € MBS Recombinant Proteins salmonella
EKU07330 Sialidase 2, Cytosolic (SIAL2) ELISA kit 1 plate of 96 wells 888 € Biomatik ELISA kits human
GENTAUR-58ba12d5b8579 Sialidase 100ug 2067 € MBS Recombinant Proteins human
GENTAUR-58ba12d644ab3 Sialidase 1000ug 2067 € MBS Recombinant Proteins human
GENTAUR-58ba12d6f3625 Sialidase 100ug 2580 € MBS Recombinant Proteins human