| Catalog number: | C999 |
|---|---|
| Price: | 2580 € |
| Supplier: | MBS Recombinant Proteins |
| Product name: | Recombinant Human Sialidase-1, NEU-1 (C-6His) |
| Quantity: | 100ug |
| Other quantities: | 1 mg 2283€ 10 µg 202€ 500 µg 1613€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human Sialidase-1 is produced by our Mammalian expression system and the target gene encoding Glu48-Leu415 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: | 27 kD, 41 |
| UniProt number: | Q99519 |
| State of the product: | Liquid |
| Shipping conditions: | Dry Ice/ice packs |
| Formulation: | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7 |
| Storage recommendations: | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | ENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTLVDHHHHHH |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | NEU-1 (C-6His), Sialidase-1 |
| Short name: | NEU-1 (C-6His), Recombinant Sialidase-1 |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | NEU-1 (C-6His), sapiens Sialidase-1, recombinant H |
| Alternative technique: | rec |
| Identity: | 7761 |
| Gene: | NEURL1 | More about : NEURL1 |
| Long gene name: | neuralized E3 ubiquitin protein ligase 1 |
| Synonyms gene: | NEURL |
| Synonyms gene name: | neuralized (Drosophila)-like neuralized-like (Drosophila) neuralized homolog (Drosophila) |
| Synonyms: | h-neu RNF67 neu-1 |
| Locus: | 10q24, 33 |
| Discovery year: | 1999-02-09 |
| GenBank acession: | U87864 |
| Entrez gene record: | 9148 |
| Pubmed identfication: | 9519875 20847082 |
| Classification: | Ring finger proteins |
| Havana BLAST/BLAT: | OTTHUMG00000018995 |
| C999 | Recombinant Human Sialidase-1, NEU-1 (C-6His) | 1 mg | 2283 € | novo | human |
| GWB-766066 | Sialidase 1 (lysosomal Sialidase) (NEU1) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody | 1 tube | 602 € | genways | human |
| GENTAUR-58bd58c87067a | human Sialidase-3 protein | 1 mg | 1475 € | MBS Recombinant Proteins | human |
| GENTAUR-58bd58c8b99d1 | human Sialidase-3 protein | 0.05 mg | 265 € | MBS Recombinant Proteins | human |
| GENTAUR-58bd58c8ee795 | human Sialidase-3 protein | 0.2 mg | 564 € | MBS Recombinant Proteins | human |
| GENTAUR-58bd58c93a100 | human Sialidase-3 protein | 0.5 mg | 951 € | MBS Recombinant Proteins | human |
| MBS221018 | Anti-BACTERIAL SIALIDASE Antibody | 1 mililiter | 486 € | MBS Polyclonals_1 | human |
| abx571264 | Anti-Rat Sialidase 2, Cytosolic (SIAL2) ELISA Kit | 96 tests | 833 € | abbex | rat |
| AR50509PU-N | anti-Sialidase 1 (48-415, His-tag) Antibody | 0,5 mg | 1413 € | acr | human |
| AR50509PU-S | anti-Sialidase 1 (48-415, His-tag) Antibody | 0,1 mg | 587 € | acr | human |
| AM26497AF-N | anti-Sialidase-3 Antibody | 0,1 mg | 572 € | acr | human |
| AP52856PU-N | anti-Sialidase-4 (C-term) Antibody | 0,4 ml | 587 € | acr | human |
| GWB-9CC345 | Bacterial Sialidase antibody | 1 vial | 585 € | genways | human |
| GENTAUR-58ba639fbfe7b | Mouse Sialidase-1 (Neu1) | 100ug | 2045 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58ba63a051094 | Mouse Sialidase-1 (Neu1) | 1000ug | 2045 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58ba63a10061f | Mouse Sialidase-1 (Neu1) | 100ug | 2558 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58ba63a168cda | Mouse Sialidase-1 (Neu1) | 1000ug | 2558 € | MBS Recombinant Proteins | mouse |
| DL-SIAL2-Ra | Rat Sialidase 2, Cytosolic SIAL2 ELISA Kit | 96T | 962 € | DL elisas | rat |
| GENTAUR-58b8f9c06a591 | Salmonella typhimurium Sialidase (nanH) | 100ug | 2078 € | MBS Recombinant Proteins | salmonella |
| GENTAUR-58b8f9c0c97b4 | Salmonella typhimurium Sialidase (nanH) | 1000ug | 2078 € | MBS Recombinant Proteins | salmonella |
| GENTAUR-58b8f9c13fe9a | Salmonella typhimurium Sialidase (nanH) | 100ug | 2592 € | MBS Recombinant Proteins | salmonella |
| GENTAUR-58b8f9c19ca16 | Salmonella typhimurium Sialidase (nanH) | 1000ug | 2592 € | MBS Recombinant Proteins | salmonella |
| GENTAUR-58b9f7cf3a6ed | Salmonella typhimurium Sialidase (nanH) | 100ug | 2078 € | MBS Recombinant Proteins | salmonella |
| GENTAUR-58b9f7cfd1bd7 | Salmonella typhimurium Sialidase (nanH) | 1000ug | 2078 € | MBS Recombinant Proteins | salmonella |
| GENTAUR-58b9f7d077d3d | Salmonella typhimurium Sialidase (nanH) | 100ug | 2592 € | MBS Recombinant Proteins | salmonella |
| GENTAUR-58b9f7d10369f | Salmonella typhimurium Sialidase (nanH) | 1000ug | 2592 € | MBS Recombinant Proteins | salmonella |
| EKU07330 | Sialidase 2, Cytosolic (SIAL2) ELISA kit | 1 plate of 96 wells | 888 € | Biomatik ELISA kits | human |
| GENTAUR-58ba12d5b8579 | Sialidase | 100ug | 2067 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba12d644ab3 | Sialidase | 1000ug | 2067 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba12d6f3625 | Sialidase | 100ug | 2580 € | MBS Recombinant Proteins | human |