Recombinant Human Aldo-Keto Reductase 1C3, AKR1C3 (C-6His)

Contact us
Catalog number: C985
Price: 1835 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Aldo-Keto Reductase 1C3, AKR1C3 (C-6His)
Quantity: 1000ug
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Aldo-Keto Reductase 1C3 is produced by our Mammalian expression system and the target gene encoding Met1-Tyr323 is expressed with a 6His tag at the C-terminus
Molecular Weight: 37, 8 kD
UniProt number: P42330
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEYVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: AKR1C3 (C-6His), Aldo-Keto Reductase 1C3
Short name: AKR1C3 (C-6His), Recombinant Aldo-Keto Reductase 1C3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: aldo-keto reductase family 1, classification II) (C-6His), member complement component 3 (3-a hydroxysteroid dehydrogenase, sapiens Aldo-Keto Reductase 1C3, recombinant H
Alternative technique: rec
Alternative to gene target: AKR1C3 and IDBG-47964 and ENSG00000196139 and 8644, DD3 and DDX and HA1753 and HAKRB and HAKRe and hluPGFS and HSD17B5 and PGFS, acting on NAD(P)H, acting on NAD(P)H, acting on NAD(P)H, member C3 (3-alpha hydroxysteroid dehydrogenase, nuclei, oxidoreductase activity, quinone or similar compound as acceptor, quinone or similar compound as acceptor and also this GO :0018636 : phenanthrene 9, quinone or similar compound as acceptor and molecular function this GO :0018636 and phenanthrene 9, this GO :0000060 and protein import into nucleus, this GO :0001758 : retinal dehydrogenase activity, this GO :0001758 : retinal dehydrogenase activity and also this GO :0004032 : alditol:NADP+ 1-oxidoreductase activity and also this GO :0004033 : aldo-keto reductase (NADP) activity and also this GO :0004745 : retinol dehydrogenase activity and also this GO :0004958 : prostaglandin F receptor activity and also this GO :0016491 : oxidoreductase activity and also this GO :0016655 : oxidoreductase activity, this GO :0004032 : alditol:NADP+ 1-oxidoreductase activity, this GO :0004033 : aldo-keto reductase (NADP) activity, this GO :0004745 : retinol dehydrogenase activity, this GO :0004958 : prostaglandin F receptor activity, this GO :0016491 : oxidoreductase activity, this GO :0016655 : oxidoreductase activity, this GO :0018636 : phenanthrene 9, this GO :0035410 : dihydrotestosterone 17-beta-dehydrogenase activity, this GO :0036131 : prostaglandin D2 11-ketoreductase activity, this GO :0045550 : geranylgeranyl reductase activity, this GO :0045703 : ketoreductase activity, this GO :0047017 : prostaglandin-F synthase activity, this GO :0047020 : 15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity, this GO :0047023 : androsterone dehydrogenase activity, this GO :0047035 : testosterone dehydrogenase (NAD+) activity, this GO :0047045 : testosterone 17-beta-dehydrogenase (NADP+) activity, this GO :0047086 : ketosteroid monooxygenase activity, this GO :0047115 : trans-1, this GO :0047718 : indanol dehydrogenase activity, this GO :0047787 : delta4-3-oxosteroid 5beta-reductase activity, translocation and biological process this GO :0001523 and retinoid metabolic process and biological process this GO :0001758 and retinal dehydrogenase activity and molecular function this GO :0004032 and alditol:NADP+ 1-oxidoreductase activity and molecular function this GO :0004033 and aldo-keto reductase (NADP) activity and molecular function this GO :0004745 and retinol dehydrogenase activity and molecular function this GO :0004958 and prostaglandin F receptor activity and molecular function this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006693 and prostaglandin metabolic process and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007584 and response to nutrient and biological process this GO :0007603 and phototransduction, type II), visible light and biological process this GO :0008202 and steroid metabolic process and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008584 and male this GO nad development and biological process this GO :0009267 and cellular response to starvation and biological process this GO :0010942 and positive regulation of cell death and biological process this GO :0016488 and farnesol catabolic process and biological process this GO :0016491 and oxidoreductase activity and molecular function this GO :0016655 and oxidoreductase activity, 10-monooxygenase activity, 10-monooxygenase activity and also this GO :0035410 : dihydrotestosterone 17-beta-dehydrogenase activity and also this GO :0036131 : prostaglandin D2 11-ketoreductase activity and also this GO :0045550 : geranylgeranyl reductase activity and also this GO :0045703 : ketoreductase activity and also this GO :0047017 : prostaglandin-F synthase activity and also this GO :0047020 : 15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity and also this GO :0047023 : androsterone dehydrogenase activity and also this GO :0047035 : testosterone dehydrogenase (NAD+) activity and also this GO :0047045 : testosterone 17-beta-dehydrogenase (NADP+) activity and also this GO :0047086 : ketosteroid monooxygenase activity and also this GO :0047115 : trans-1, 10-monooxygenase activity and molecular function this GO :0019369 and arachidonic acid metabolic process and biological process this GO :0019371 and cyclooxygenase pathway and biological process this GO :0030216 and keratinocyte differentiation and biological process this GO :0034614 and cellular response to reactive oxygen species and biological process this GO :0034694 and response to prostaglandin stimulus and biological process this GO :0035410 and dihydrotestosterone 17-beta-dehydrogenase activity and molecular function this GO :0036131 and prostaglandin D2 11-ketoreductase activity and molecular function this GO :0042448 and progesterone metabolic process and biological process this GO :0042574 and retinal metabolic process and biological process this GO :0044259 and multicellular organismal macromolecule metabolic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0044597 and daunorubicin metabolic process and biological process this GO :0044598 and doxorubicin metabolic process and biological process this GO :0045550 and geranylgeranyl reductase activity and molecular function this GO :0045703 and ketoreductase activity and molecular function this GO :0047017 and prostaglandin-F synthase activity and molecular function this GO :0047020 and 15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity and molecular function this GO :0047023 and androsterone dehydrogenase activity and molecular function this GO :0047035 and testosterone dehydrogenase (NAD+) activity and molecular function this GO :0047045 and testosterone 17-beta-dehydrogenase (NADP+) activity and molecular function this GO :0047086 and ketosteroid monooxygenase activity and molecular function this GO :0047115 and trans-1, 2-dihydrobenzene-1, 2-dihydrobenzene-1, 2-dihydrobenzene-1, 2-diol dehydrogenase activity, 2-diol dehydrogenase activity and also this GO :0047718 : indanol dehydrogenase activity and also this GO :0047787 : delta4-3-oxosteroid 5beta-reductase activity, 2-diol dehydrogenase activity and molecular function this GO :0047718 and indanol dehydrogenase activity and molecular function this GO :0047787 and delta4-3-oxosteroid 5beta-reductase activity and molecular function this GO :0048385 and regulation of retinoic acid receptor signaling pathway and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0061370 and testosterone biosynthetic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070293 and renal absorption and biological process this GO :0071276 and cellular response to cadmium ion and biological process this GO :0071277 and cellular response to calcium ion and biological process this GO :0071379 and cellular response to prostaglandin stimulus and biological process this GO :0071384 and cellular response to corticosteroid stimulus and biological process this GO :0071395 and cellular response to jasmonic acid stimulus and biological process this GO :1900053 and negative regulation of retinoic acid biosynthetic process and biological process this GO :2000224 and regulation of testosterone biosynthetic process and biological process this GO :2000353 and positive regulation of endothelial cell apoptotic process and biological process this GO :2000379 and positive regulation of reactive oxygen species metabolic process and biological process, aldo-keto reductase family 1
Identity: 386
Gene: AKR1C3 | More about : AKR1C3
Long gene name: aldo-keto reductase family 1 member C3
Synonyms gene: HSD17B5
Synonyms gene name: hydroxysteroid (17-beta) dehydrogenase 5 aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II)
Synonyms: KIAA0119 DDX HAKRB PGFS
Synonyms name: dihydrodiol dehydrogenase X prostaglandin F synthase 3-alpha hydroxysteroid dehydrogenase, type II
Locus: 10p15, 1
Discovery year: 1998-09-29
GenBank acession: L43839
Entrez gene record: 8644
Pubmed identfication: 7650035 9792917
RefSeq identity: NM_003739
Classification: Aldo-keto reductases
Havana BLAST/BLAT: OTTHUMG00000017585

Related Products :

C985 Recombinant Human Aldo-Keto Reductase 1C3, AKR1C3 (C-6His) 500 µg 1613 € novo human
MBS619554 aldo keto reductase family 1, member C2 (AKR1C2, 3-alpha-HSD3, AKR1C-pseudo, Aldo-keto reductase family 1 member C2, BABP, Chlordecone reductase homolog HAKRD, DD, DD/BABP, DD2, DDH2, Dihydrodiol dehydrogenase/bile acid-binding protein, Dihydrodiol dehydr Antibody 0.04 mg 370 € MBS Polyclonals_1 human
CE36 Recombinant Human Aldo-Keto Reductase 1C4, AKR1C4 (N-6His) 1 mg 2283 € novo human
MBS624440 AKR1B1, CT (Aldose Reductase, AR, Aldehyde Reductase, Aldo-keto Reductase Family 1 Member B1, ALDR1) Antibody 200ul 597 € MBS Polyclonals_1 human
GWB-8A132B Aldo-keto Reductase Family 1 Member A1 (aldehyde reductase) (AKR1A1) Goat antibody to or anti-Human Polyclonal (C- terminus) antibody 1 vial 648 € genways human
GWB-2AC025 Aldo-Keto Reductase Family 1 Member B10 (Aldose Reductase) (AKR1B10) Rabbit antibody to or anti-Human Polyclonal (aa100-200) antibody 1 x 1 vial 602 € genways human
C295 Recombinant Human Aldo-Keto Reductase 1C2, AKR1C2 500 µg 1613 € novo human
GWB-5017B0 Recombinant Human Aldo-Keto Reductase Family 1 Member A1 bulk Ask price € genways bulk human
GWB-D98F00 Recombinant Human Aldo-Keto Reductase Family 1 Member B10 bulk Ask price € genways bulk human
GWB-368522 Recombinant Human Aldo-Keto Reductase Family 1 Member C3 bulk Ask price € genways bulk human
GWB-200018 Recombinant Human Aldo-Keto Reductase Family 7 Member A2 bulk Ask price € genways bulk human
GWB-994365 Recombinant Human Aldo-Keto Reductase Family 7 Member A3 bulk Ask price € genways bulk human
abx250482 Anti-Human Aldo-keto reductase family 1 member B10 ELISA Kit 96 tests 659 € abbex human
abx250867 Anti-Human Aldo-keto reductase family 1 member C1 ELISA Kit inquire 50 € abbex human
abx251567 Anti-Human Aldo-keto reductase family 1 member C4 ELISA Kit inquire 50 € abbex human
GENTAUR-58bb7e1aef36c Human Aldo-keto reductase family 1 member B15 (AKR1B15) 100ug 1984 € MBS Recombinant Proteins human
GENTAUR-58bb7e1b4e06c Human Aldo-keto reductase family 1 member B15 (AKR1B15) 1000ug 1984 € MBS Recombinant Proteins human
GENTAUR-58bb7e1b8d9ea Human Aldo-keto reductase family 1 member B15 (AKR1B15) 100ug 2498 € MBS Recombinant Proteins human
GENTAUR-58bb7e1bdaeed Human Aldo-keto reductase family 1 member B15 (AKR1B15) 1000ug 2498 € MBS Recombinant Proteins human
GENTAUR-58bdc0f16926a Mouse Anti-Human Aldo-Keto Reductase Family 1 Member C1 Antibody 0.02 miligrams 277 € MBS mono human
GENTAUR-58bdc0f1cae34 Mouse Anti-Human Aldo-Keto Reductase Family 1 Member C1 Antibody 0.005 miligrams 205 € MBS mono human
GENTAUR-58bdc0f2452a6 Mouse Anti-Human Aldo-Keto Reductase Family 1 Member C1 Antibody 100ug 608 € MBS mono human
GENTAUR-58bdc0ec9df62 Mouse Anti-Human Aldo-Keto Reductase Family 7 Member A3 Antibody 0.005 miligrams 205 € MBS mono human
GENTAUR-58bdc0ed153c9 Mouse Anti-Human Aldo-Keto Reductase Family 7 Member A3 Antibody 100ug 608 € MBS mono human
GENTAUR-58bdc0ed6f176 Mouse Anti-Human Aldo-Keto Reductase Family 7 Member A3 Antibody 0.02 miligrams 277 € MBS mono human
F53904-0.05ML AKR7A3 Antibody / Aldo keto reductase family 7 member A3 0.05 ml 199 € NJS poly human
F53910-0.05ML AKR7A3 Antibody / Aldo keto reductase family 7 member A3 0.05 ml 199 € NJS poly human
F53910-0.2ML AKR7A3 Antibody / Aldo keto reductase family 7 member A3 0.2 ml 406 € NJS poly human
GENTAUR-58ba7108671b8 Aldo-keto reductase 100ug 1835 € MBS Recombinant Proteins human
GENTAUR-58ba7108f3ca2 Aldo-keto reductase 1000ug 1835 € MBS Recombinant Proteins human