| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Aldo-Keto Reductase 1C3 is produced by our E, coli expression system and the target gene encoding Met1-Tyr323 is expressed |
| Molecular Weight: |
36, 74 kD |
| UniProt number: |
P52895 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
1 mM DTT, 100 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
AKR1C2, Aldo-Keto Reductase 1C2 |
| Short name: |
AKR1C2, Recombinant Aldo-Keto Reductase 1C2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
3-a hydroxysteroid dehydrogenase, aldo-keto reductase family 1, bile acid binding protein, classification III), member complement component 2 (dihydrodiol dehydrogenase 2, sapiens Aldo-Keto Reductase 1C2, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
3-alpha hydroxysteroid dehydrogenase, AKR1C-pseudo and BABP and DD and DD2 and DDH2 and HAKRD and HBAB and MCDR2 and SRXY8 and TDD, AKR1C2 and IDBG-47297 and ENSG00000151632 and 1646, Cytoplasm, acting on NAD(P)H, acting on NAD(P)H, acting on NAD(P)H, bile acid binding protein, member C2 (dihydrodiol dehydrogenase 2, oxidoreductase activity, quinone or similar compound as acceptor, quinone or similar compound as acceptor and also this GO :0018636 : phenanthrene 9, quinone or similar compound as acceptor and molecular function this GO :0018636 and phenanthrene 9, this GO :0004032 and alditol:NADP+ 1-oxidoreductase activity and molecular function this GO :0004958 and prostaglandin F receptor activity and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0006693 and prostaglandin metabolic process and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007586 and digestion and biological process this GO :0008202 and steroid metabolic process and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0016491 and oxidoreductase activity and molecular function this GO :0016655 and oxidoreductase activity, this GO :0004032 : alditol:NADP+ 1-oxidoreductase activity, this GO :0004032 : alditol:NADP+ 1-oxidoreductase activity and also this GO :0004958 : prostaglandin F receptor activity and also this GO :0016491 : oxidoreductase activity and also this GO :0016655 : oxidoreductase activity, this GO :0004958 : prostaglandin F receptor activity, this GO :0016491 : oxidoreductase activity, this GO :0016655 : oxidoreductase activity, this GO :0018636 : phenanthrene 9, this GO :0031406 : carboxylic acid binding, this GO :0032052 : bile acid binding, this GO :0047086 : ketosteroid monooxygenase activity, this GO :0047115 : trans-1, type III), 10-monooxygenase activity, 10-monooxygenase activity and also this GO :0031406 : carboxylic acid binding and also this GO :0032052 : bile acid binding and also this GO :0047086 : ketosteroid monooxygenase activity and also this GO :0047115 : trans-1, 10-monooxygenase activity and molecular function this GO :0030855 and epithelial cell differentiation and biological process this GO :0031406 and carboxylic acid binding and molecular function this GO :0032052 and bile acid binding and molecular function this GO :0034694 and response to prostaglandin stimulus and biological process this GO :0042448 and progesterone metabolic process and biological process this GO :0044597 and daunorubicin metabolic process and biological process this GO :0044598 and doxorubicin metabolic process and biological process this GO :0047086 and ketosteroid monooxygenase activity and molecular function this GO :0047115 and trans-1, 2-dihydrobenzene-1, 2-dihydrobenzene-1, 2-dihydrobenzene-1, 2-diol dehydrogenase activity, 2-diol dehydrogenase activity, 2-diol dehydrogenase activity and molecular function this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0071395 and cellular response to jasmonic acid stimulus and biological process, aldo-keto reductase family 1 |
| Identity: |
385 |
| Gene: |
AKR1C2 |
More about : AKR1C2 |
| Long gene name: |
aldo-keto reductase family 1 member C2 |
| Synonyms gene: |
DDH2 TDD |
| Synonyms gene name: |
3-alpha hydroxysteroid dehydrogenase, aldo-keto reductase family 1, bile acid binding protein, member C2 (dihydrodiol dehydrogenase 2, type III) testicular 17, 20-desmolase deficiency |
| Synonyms: |
DD BABP DD2 HAKRD MCDR2 |
| Synonyms name: |
3-alpha hydroxysteroid dehydrogenase, bile acid binding protein, dihydrodiol dehydrogenase 2, type III |
| Locus: |
10p15, 1 |
| Discovery year: |
1994-09-14 |
| GenBank acession: |
L32592 |
| Entrez gene record: |
1646 |
| Pubmed identfication: |
9716498 21802064 |
| RefSeq identity: |
NM_001354 |
| Classification: |
Aldo-keto reductases |
| Havana BLAST/BLAT: |
OTTHUMG00000017584 |