Recombinant Human Cyclin-Dependent Kinase 2-Associated Protein 1, CDK2AP1 (C-6His)

Contact us
Catalog number: C977
Price: 603 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Cyclin-Dependent Kinase 2-Associated Protein 1, CDK2AP1 (C-6His)
Quantity: 200ul
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CDK2AP1 is produced by our Mammalian expression system and the target gene encoding Met1-Ser115 is expressed with a 6His tag at the C-terminus
Molecular Weight: 13, 4 kD
UniProt number: O14519
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARSVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CDK2AP1 (C-6His), Cyclin-Dependent Kinase 2-Associated Protein 1
Short name: CDK2AP1 (C-6His), Recombinant Cyclin-Dependent Kinase 2-Associated Protein 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CDK2AP1 (C-6His), sapiens Cyclin-Dependent phosphorylation catalyst 2-Associated Protein 1, recombinant H
Alternative technique: rec
Identity: 14002
Gene: CDK2AP1 | More about : CDK2AP1
Long gene name: cyclin dependent kinase 2 associated protein 1
Synonyms gene name: CDK2-associated protein 1
Synonyms: DORC1 doc-1 DOC1 ST19 p12DOC-1
Locus: 12q24, 31
Discovery year: 2001-06-21
GenBank acession: AB006077
Entrez gene record: 8099
Pubmed identfication: 9331572 9506968
RefSeq identity: NM_004642
Havana BLAST/BLAT: OTTHUMG00000168854

Related Products :

C977 Recombinant Human Cyclin-Dependent Kinase 2-Associated Protein 1, CDK2AP1 (C-6His) 10 µg 202 € novo human
GENTAUR-58ba5f55c8df2 Human Cyclin-dependent kinase 2-associated protein 1 (CDK2AP1) 100ug 1404 € MBS Recombinant Proteins human
GENTAUR-58ba5f56cb56b Human Cyclin-dependent kinase 2-associated protein 1 (CDK2AP1) 1000ug 1404 € MBS Recombinant Proteins human
GENTAUR-58ba5f5745a50 Human Cyclin-dependent kinase 2-associated protein 1 (CDK2AP1) 100ug 1912 € MBS Recombinant Proteins human
GENTAUR-58ba5f57d288f Human Cyclin-dependent kinase 2-associated protein 1 (CDK2AP1) 1000ug 1912 € MBS Recombinant Proteins human
YSGKAMCC107E Cyclin Dependent Kinase 2 (cdk2), Cyclin Dependent Kinase 5 (cdk5), NO X w/Cyclin Dependent Kinase (cdk)1, ~33kD, Clone: 8A12, Mouse Monoclonal antibody-Human, Mouse; WB 0.1mg 1271 € accurate-monoclonals mouse
GENTAUR-58ba913d6c978 Mouse Cyclin-dependent kinase 2-associated protein 1 (Cdk2ap1) 100ug 1404 € MBS Recombinant Proteins mouse
GENTAUR-58ba913e206ef Mouse Cyclin-dependent kinase 2-associated protein 1 (Cdk2ap1) 1000ug 1404 € MBS Recombinant Proteins mouse
GENTAUR-58ba913eae71a Mouse Cyclin-dependent kinase 2-associated protein 1 (Cdk2ap1) 100ug 1906 € MBS Recombinant Proteins mouse
GENTAUR-58ba913f40b9b Mouse Cyclin-dependent kinase 2-associated protein 1 (Cdk2ap1) 1000ug 1906 € MBS Recombinant Proteins mouse
MBS616679 CDKN1B (CDKN1B, cyclin-dependent kinase inhibitor 1B (p27, Kip1), KIP1, CDKN4, P27KIP1, cyclin-dependent kinase inhibitor 1B, p27(KIP1), KIP1, p27) 100ug 735 € MBS Polyclonals_1 human
MBS624101 p27Kip1, phosphorylated (Thr198) (Cyclin-dependent Kinase Inhibitor 1B, Cyclin-dependent Kinase Inhibitor p27, CDKN1B, KIP1) 200ul 603 € MBS Polyclonals_1 human
C211 Recombinant Human Cyclin-Dependent Kinase 2, CDK2 (N-6His) 500 µg 1613 € novo human
CF12 Recombinant Human Cyclin-Dependent Kinase 4, CDK4 (N-6His) 50 µg 369 € novo human
C243 Recombinant Human Cyclin-Dependent Kinase 4 Inhibitor C, CDKN2C (N-6His) 10 µg 202 € novo human
CF11 Recombinant Human Cyclin-Dependent Kinase 6, CDK6 (N-6His) 1 mg 2283 € novo human
C842 Recombinant Human Cyclin-Dependent Kinase 7, CDK7 (N-6His) 50 µg 496 € novo human
CE72 Recombinant Human Cyclin-Dependent Kinase Inhibitor 1, CDKN1A, p21 (C-6His) 1 mg 2283 € novo human
C288 Recombinant Human Cyclin-Dependent Kinase Inhibitor 1B, CDKN1B (N-6His) 50 µg 496 € novo human
MBS611554 ROK alpha (Rho-associated Kinase-alpha, ROK-alpha, Rho-associated Coiled-coil Containing Protein Kinase 2, Rho-associated Protein Kinase 2, Rho Kinase 2, ROCK2, Rock2m, ROCK-2, p164 ROCK-2, ROCK-II, Rho-kinase) Antibody 100ug 785 € MBS Polyclonals_1 human
GWB-P1558K CDK2AP1, 1-115aa, Recombinant Protein bulk Ask price € genways bulk human
YSGKAMCC200E Cyclin D1, Cyclin D2, NO X w/Cyclin D3, ~36&34kD, Clone: 5D4, Mouse Monoclonal antibody-Human, Mouse; WB/ICC/IHC 0.1mg 1097 € accurate-monoclonals mouse
GWB-AC1F26 Recombinant Human Cyclin-Dependent Kinase 2 Associated Protein 1 bulk Ask price € genways bulk human
LV791301 CDK2AP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV791302 CDK2AP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV791303 CDK2AP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV791304 CDK2AP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
MBS248771 PAb (IgG) to Human DOC-1 / CDK2AP1 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS622298 Hematopoietic Progenitor Kinase 1 (HPK1, Mitogen-activated Protein Kinase Kinase Kinase Kinase 1, MAP4K1, MAPK/ERK Kinase Kinase Kinase 1, MEK Kinase Kinase 1, MEKKK 1) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS624216 MAP4K1, phosphorylated (Ser171) (Mitogen-activated Protein Kinase Kinase Kinase Kinase 1, MAPK/ERK Kinase Kinase Kinase 1, MEK Kinase Kinase 1, MEKKK 1, Hematopoietic Progenitor Kinase, HPK1) Antibody 200ul 603 € MBS Polyclonals_1 human