| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human COL8A1 is produced by our Mammalian expression system and the target gene encoding Gly28-Met744 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
6 kD, 71 |
| UniProt number: |
P27658 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GAYYGIKPLPPQIPPQMPPQIPQYQPLGQQVPHMPLAKDGLAMGKEMPHLQYGKEYPHLPQYMKEIQPAPRMGKEAVPKKGKEIPLASLRGEQGPRGEPGPRGPPGPPGLPGHGIPGIKGKPGPQGYPGVGKPGMPGMPGKPGAMGMPGAKGEIGQKGEIGPMGIPGPQGPPGPHGLPGIGKPGGPGLPGQPGPKGDRGPKGLPGPQGLRGPKGDKGFGMPGAPGVKGPPGMHGPPGPVGLPGVGKPGVTGFPGPQGPLGKPGAPGEPGPQGPIGVPGVQGPPGIPGIGKPGQDGIPGQPGFPGGKGEQGLPGLPGPPGLPGIGKPGFPGPKGDRGMGGVPGALGPRGEKGPIGAPGIGGPPGEPGLPGIPGPMGPPGAIGFPGPKGEGGIVGPQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEAGQKGVPGLPGVPGLLGPKGEPGIPGDQGLQGPPGIPGIGGPSGPIGPPGIPGPKGEPGLPGPPGFPGIGKPGVAGLHGPPGKPGALGPQGQPGLPGPPGPPGPPGPPAVMPPTPPPQGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPMVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
COL8A1 (C-6His), -1(VIII) Chain, Collagen &alpha |
| Short name: |
COL8A1 (C-6His), -1(VIII) Chain, Recombinant Collagen &alpha |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
a 1 (C-6His), classification VIII, collagen, sapiens Collagen &alpha, -1(VIII) epitope, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
C3orf7, COL8A1 and IDBG-47120 and ENSG00000144810 and 1295, COL8A1 and IDBG-631089 and ENSBTAG00000013662 and 538564, Col8a1 and IDBG-168817 and ENSMUSG00000068196 and 12837, Extracellular, alpha 1, protein binding, this GO :0001525 and angiogenesis and biological process this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005591 and collagen type VIII and cellular component this GO :0005788 and endoplasmic reticulum lumen and cellular component this GO :0007155 and cell adhesion and biological process this GO :0010811 and positive regulation of cell-substrate adhesion and biological process this GO :0022617 and extracellular matrix disassembly and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030574 and collagen catabolic process and biological process this GO :0031012 and extracellular matrix and cellular component this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0048593 and camera-type eye morphogenesis and biological process this GO :0050673 and epithelial cell proliferation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding, type VIII, collagen |
| Identity: |
2215 |
| Gene: |
COL8A1 |
More about : COL8A1 |
| Long gene name: |
collagen type VIII alpha 1 chain |
| Synonyms gene: |
C3orf7 |
| Synonyms gene name: |
alpha 1 , chromosome 3 open reading frame 7 collagen, type VIII |
| Synonyms: |
MGC9568 |
| Locus: |
3q12, 1 |
| Discovery year: |
1991-08-17 |
| GenBank acession: |
AF170702 |
| Entrez gene record: |
1295 |
| Pubmed identfication: |
2029894 |
| RefSeq identity: |
NM_001850 |
| Classification: |
Collagens |
| Havana BLAST/BLAT: |
OTTHUMG00000148669 |