| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse COL3A1 is produced by our Mammalian expression system and the target gene encoding Gln155-Gly1219 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
6 kD, 96 |
| UniProt number: |
P08121 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
pH4, 150 mM sodium chloride, 2 um filtered solution of 20 mM HAc-NaAc, 5, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QFDSYDVKSGVGGMGGYPGPAGPPGPPGPPGSSGHPGSPGSPGYQGPPGEPGQAGPAGPPGPPGALGPAGPAGKDGESGRPGRPGERGLPGPPGIKGPAGMPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGDNGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGSPGQRGEPGPQGHAGAQGPPGPPGNNGSPGGKGEMGPAGIPGAPGLIGARGPPGPAGTNGIPGTRGPSGEPGKNGAKGEPGARGERGEAGSPGIPGPKGEDGKDGSPGEPGANGLPGAAGERGPSGFRGPAGPNGIPGEKGPPGERGGPGPAGPRGVAGEPGRDGTPGGPGIRGMPGSPGGPGNDGKPGPPGSQGESGRPGPPGPSGPRGQPGVMGFPGPKGNDGAPGKNGERGGPGGPGLPGPAGKNGETGPQGPPGPTGPAGDKGDSGPPGPQGLQGIPGTGGPPGENGKPGEPGPKGEVGAPGAPGGKGDSGAPGERGPPGTAGIPGARGGAGPPGPEGGKGPAGPPGPPGASGSPGLQGMPGERGGPGSPGPKGEKGEPGGAGADGVPGKDGPRGPAGPIGPPGPAGQPGDKGEGGSPGLPGIAGPRGGPGERGEHGPPGPAGFPGAPGQNGEPGAKGERGAPGEKGEGGPPGPAGPTGSSGPAGPPGPQGVKGERGSPGGPGTAGFPGGRGLPGPPGNNGNPGPPGPSGAPGKDGPPGPAGNSGSPGNPGIAGPKGDAGQPGEKGPPGAQGPPGSPGPLGIAGLTGARGLAGPPGMPGPRGSPGPQGIKGESGKPGASGHNGERGPPGPQGLPGQPGTAGEPGRDGNPGSDGQPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPSGKSGDRGETGPAGPSGAPGPAGARGAPGPQGPRGDKGETGERGSNGIKGHRGFPGNPGPPGSPGAAGHQGAIGSPGPAGPRGPVGPHGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGGAAAIAGVGGEKSGGFSPYYGVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
COL3A1 (C-6His), -1(III) Chain, Collagen &alpha |
| Short name: |
COL3A1 (C-6His), -1(III) Chain, Recombinant Mouse Collagen &alpha |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses |
| Alternative name: |
a 1 (C-6His), classification III, collagen, -1(III) epitope, recombinant Mouse Collagen &alpha |
| Alternative technique: |
rec |
| Alternative to gene target: |
BT, COL3A1 and IDBG-77195 and ENSG00000168542 and 1281, Col3a1 and IDBG-150792 and ENSMUSG00000026043 and 12825, EDS4A, Extracellular, alpha 1, platelet-derived growth factor binding, this GO :0001501 and skeletal system development and biological process this GO :0001568 and blood vessel development and biological process this GO :0005178 and integrin binding and molecular function this GO :0005201 and extracellular matrix structural constituent and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005581 and collagen trimer and cellular component this GO :0005586 and collagen type III and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005788 and endoplasmic reticulum lumen and cellular component this GO :0007160 and cell-matrix adhesion and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007229 and integrin-mediated signaling pathway and biological process this GO :0007411 and axon guidance and biological process this GO :0007507 and heart development and biological process this GO :0007568 and aging and biological process this GO :0009314 and response to radiation and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0018149 and peptide cross-linking and biological process this GO :0021987 and cerebral cortex development and biological process this GO :0022617 and extracellular matrix disassembly and biological process this GO :0030168 and platelet activation and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030199 and collagen fibril organization and biological process this GO :0030574 and collagen catabolic process and biological process this GO :0031012 and extracellular matrix and cellular component this GO :0034097 and response to cytokine and biological process this GO :0035025 and positive regulation of Rho protein signal transduction and biological process this GO :0042060 and wound healing and biological process this GO :0043206 and extracellular fibril organization and biological process this GO :0043588 and skin development and biological process this GO :0046332 and SMAD binding and molecular function this GO :0046872 and metal ion binding and molecular function this GO :0048407 and platelet-derived growth factor binding and molecular function this GO :0048565 and digestive tract development and biological process this GO :0050777 and negative regulation of immune response and biological process this GO :0071230 and cellular response to amino acid stimulus and biological process this GO :2001223 and negative regulation of neuron migration and biological process, this GO :0005178 : integrin binding, this GO :0005178 : integrin binding and also this GO :0005201 : extracellular matrix structural constituent and also this GO :0005515 : protein binding and also this GO :0046332 : SMAD binding and also this GO :0046872 : metal ion binding and also this GO :0048407 : platelet-derived growth factor binding, this GO :0005201 : extracellular matrix structural constituent, this GO :0005515 : protein binding, this GO :0046332 : SMAD binding, this GO :0046872 : metal ion binding, this GO :0048407 : platelet-derived growth factor binding, type III, 64714 and IDBG-639630 and ENSBTAG00000021466 and 510833, collagen |
| Identity: |
2201 |
| Gene: |
COL3A1 |
More about : COL3A1 |
| Long gene name: |
collagen type III alpha 1 chain |
| Synonyms gene: |
EDS4A |
| Synonyms gene name: |
Ehlers-Danlos syndrome type IV, alpha 1 , autosomal dominant collagen, type III |
| Locus: |
2q32, 2 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
X15332 |
| Entrez gene record: |
1281 |
| Pubmed identfication: |
2780304 2834369 |
| RefSeq identity: |
NM_000090 |
| Classification: |
Collagens |
| Havana BLAST/BLAT: |
OTTHUMG00000132648 |
| Locus Specific Databases: |
Ehlers-Danlos Syndrome Variant Database LRG_3 |