Recombinant Human Galectin-3, LGALS3 (C-6His, Human Cells)

Contact us
Catalog number: C846
Price: 322 €
Supplier: ABM lentivectors
Product name: Recombinant Human Galectin-3, LGALS3 (C-6His, Human Cells)
Quantity: 1.0 µg DNA
Other quantities: 1 mg 1674€ 10 µg 141€ 50 µg 303€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Galectin-3 is produced by our Mammalian expression system and the target gene encoding Ala2-Ile250 is expressed with a 6His tag at the C-terminus
Molecular Weight: 2 kD, 27
UniProt number: P17931
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 3 mM DTT, pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Cells), LGALS3 (C-6His, Galectin-3
Short name: Cells), LGALS3 (C-6His, Recombinant Galectin-3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: H, LGALS3 (C-6His, sapiens Cells), sapiens Galectin-3, recombinant H
Alternative technique: rec
Identity: 6563
Gene: LGALS3 | More about : LGALS3
Long gene name: galectin 3
Synonyms gene: LGALS2
Synonyms gene name: 3 , galactoside-binding, lectin, soluble
Synonyms: MAC-2 GALIG
Synonyms name: advanced glycation end-product receptor 3
Locus: 14q22, 3
Discovery year: 1991-09-13
GenBank acession: M64303
Entrez gene record: 3958
Pubmed identfication: 2009535 8063692
RefSeq identity: NM_002306
Classification: Endogenous ligands Galectins
Havana BLAST/BLAT: OTTHUMG00000171030

Related Products :

C846 Recombinant Human Galectin-3, LGALS3 (C-6His, Human Cells) 50 µg 303 € novo human
C068 Recombinant Human Galectin-3, LGALS3 (E. coli) 50 µg 192 € novo e-coli
RP-0999H Recombinant Human Galectin-3 / LGALS3 Protein, Low Endotoxin 10μg 624 € adv human
BB-EK0764 anti-Human Galectin-3/ LGALS3 ELISA Kit Antibody 96 Tests 717 € acr human
BB-EK0765 anti-Mouse Galectin-3/ LGALS3 ELISA Kit Antibody 96 Tests 717 € acr mouse
GENTAUR-58bc645f6e9b5 Cricetulus longicaudatus Galectin-3 (LGALS3) 100ug 1730 € MBS Recombinant Proteins human
GENTAUR-58bc645fe648c Cricetulus longicaudatus Galectin-3 (LGALS3) 1000ug 1730 € MBS Recombinant Proteins human
GENTAUR-58bc64602deaf Cricetulus longicaudatus Galectin-3 (LGALS3) 100ug 2243 € MBS Recombinant Proteins human
GENTAUR-58bc646073bbd Cricetulus longicaudatus Galectin-3 (LGALS3) 1000ug 2243 € MBS Recombinant Proteins human
GWB-A4226E Galectin-3 (LGALS3) Rabbit antibody to or anti-Mouse Polyclonal (aa151-251) antibody 1 vial 602 € genways mouse
GENTAUR-58be254011c8a anti-CD45 RA B-cells, T-cells, NK-cells 1000ug 1028 € MBS mono human
GENTAUR-58be25408a38d anti-CD45 RA B-cells, T-cells, NK-cells 100ug 304 € MBS mono human
MBS620748 NFAT3 (NF-AT3, Cytoplasmic Nuclear Factor of Activated T cells 4, Nuclear Factor of Activated T cells Cytoplasmic 4, Nuclear Factor of Activated T cells Cytoplasmic Calcineurin Dependent 4, NF-ATc4, NFATc4, Nuclear Factor of Activated T cells, T cell Tran Antibody 100ug 509 € MBS Polyclonals_1 human
GWB-ATG056 LGALS3, 1-264 aa, mouse, His tag, E.coli , Recombinant Protein bulk Ask price € genways bulk human
C285 Recombinant Human Galectin-1, LGALS1 (C-6His) 50 µg 496 € novo human
C803 Recombinant Human Galectin-14, LGALS14 (C-6His) 10 µg 202 € novo human
C808 Recombinant Human Galectin 9 (C-6His) 50 µg 303 € novo human
CE89 Recombinant Human Galectin-Related Protein, LGALSL (C-6His) 50 µg 339 € novo human
CC79 Recombinant Human GM-CSF, CSF2 (C-6His, Human Cells) 10 µg 146 € novo human
CD98 Recombinant Human NGAL, Lipocalin-2, LCN2 (C-6His, Human Cells) 500 µg 1613 € novo human
CB01 Recombinant Human SOD2, Mn-SOD (C-6His, Human Cells) 500 µg 1613 € novo human
CA38 Recombinant Human Linker for Activation of T-Cells Family Member 2, LAT2 (C-6His) 1 mg 2283 € novo human
CA63 Recombinant Human Natural Killer Cells Antigen CD94, CD94 (N-6His) 500 µg 1613 € novo human
CI89 Recombinant Mouse Adiponectin, Acrp30, AdipoQ (C-6His, Human Cells) 500 µg 1613 € novo human
CM92 Recombinant Mouse Triggering Receptor Expressed on Myeloid Cells 2b, TREM-2b (C-6His) 50 µg 303 € novo mouse
AE58411HU-48 ELISA test for Human Lectin-galactose binding-soluble 3 (LGALS3) 1x plate of 48 wells 373 € abebio human
AE58411HU Human Lectin-galactose binding-soluble 3 (LGALS3) ELISA Kit 48 wells plate 480 € ab-elisa elisas human
AE58411HU-96 Human Lectin-galactose binding-soluble 3 (LGALS3) ELISA Kit 1x plate of 96 wells 612 € abebio human
LV204521 LGALS3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV204522 LGALS3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human