Recombinant Human S100 Calcium Binding Protein A8, A9 Heterodimer (C-6His)

Contact us
Catalog number: C796
Price: 962 €
Supplier: DL elisas
Product name: Recombinant Human S100 Calcium Binding Protein A8, A9 Heterodimer (C-6His)
Quantity: 96T
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: S100A9 Heterodimer is produced by our E, Recombinant Human S100A8 &, Thr2-Pro114(S100A9) is expressed with a 6His tag at the C-terminus, coli expression system and the target gene encoding Met1-Glu93(S100A8)&
Molecular Weight: 11, 13, 2 kD, 7&
UniProt number: P06702, P05109 &
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10%Glycerol, 150 mM sodium chloride, 2, 2 um filtered solution of 20 mM HEPES, 4, 5 mM EDTA, Supplied as a 0, pH 7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEHHHHHH&, TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: A9 Heterodimer (C-6His), S100 Calcium Binding Protein A8
Short name: A9 Heterodimer (C-6His), Recombinant S100 Calcium Binding Protein A8
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: A9 Heterodimer (C-6His), sapiens S100 Calcium Binding Protein A8, recombinant H
Alternative technique: rec

Related Products :

MBS613298 CABP9K (CALB3, CABP1, S100G, S100 calcium binding protein G, CABP, Calbindin-D9k, MGC138379, Protein S100-G, S100 calcium-binding protein G, S100D, Vitamin D-dependent calcium-binding protein, intestinal) Antibody 0.05 ml 442 € MBS Polyclonals_1 human
C796 Recombinant Human S100 Calcium Binding Protein A8, A9 Heterodimer (C-6His) 1 mg 2283 € novo human
C258 Recombinant Human S100 Calcium Binding Protein P, S100-P (N-6His) 50 µg 496 € novo human
CH98 Recombinant Human S100 Calcium Binding Protein A6, S100A6 (N-6His) 10 µg 100 € novo human
C794 Recombinant Human S100 Calcium Binding Protein A8, S100A8, Mrp8 (C-6His) 50 µg 202 € novo human
CM19 Recombinant Human S100 Calcium Binding Protein B, S100B (N-6His) 50 µg 232 € novo human
MBS623290 S100 Calcium Binding Protein A12 (S100A12, CAAF1, Calcium-binding Protein in Amniotic Fluid, Calgranulin-C, CAGC, Calgranulin Related Protein, CGRP, EN-RAGE, ENRAGE, Extracellular Newly Identified RAGE-binding Protein, Neutrophil S100 Protein, p6) 100ul 597 € MBS Polyclonals_1 human
CH68 Recombinant Mouse S100 Calcium Binding Protein A8, S100A8 (C-6His) 10 µg 156 € novo mouse
CK82 Recombinant Mouse S100 Calcium Binding Protein B, S100B (C-6His) 500 µg 1613 € novo mouse
MBS280005 Anti-Human S100 Calcium Binding Protein (S100) PAb 100ug 520 € MBS Polyclonals_1 human
DL-S100-Hu Human S100 Calcium Binding Protein S100 ELISA Kit 96T 846 € DL elisas human
MBS619446 ORAI1 (ORAI Calcium Release-Activated Calcium Modulator 1, CRACM1, FLJ14466, ORAT1, TMEM142A, calcium release-activated calcium channel protein 1, Transmembrane protein 142A) Antibody 100ug 591 € MBS Polyclonals_1 human
abx576375 Anti-Cow S100 Calcium Binding Protein (S100) ELISA Kit 96 tests 833 € abbex cow
abx573893 Anti-Rat S100 Calcium Binding Protein (S100) ELISA Kit inquire 50 € abbex rat
GENTAUR-58bdc70c34539 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdc70c87593 Anti- S100 Calcium Binding Protein (S100) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdc89941793 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc9a524974 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdca0060279 Anti- S100 Calcium Binding Protein (S100) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdca00b1b60 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdcad4a4f91 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdce44c50dc Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdce4535049 Anti- S100 Calcium Binding Protein (S100) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdcf6a53607 Anti- S100 Calcium Binding Protein (S100) Antibody 50ug 348 € MBS Polyclonals human
GENTAUR-58bdcf6aaf0ff Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bdcf9f1f8c9 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 475 € MBS Polyclonals human
GENTAUR-58bdd9d68f868 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bddc7b7cc89 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddce0e1d57 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 531 € MBS Polyclonals human
DL-S100-b Bovine S100 Calcium Binding Protein S100 ELISA Kit 96T 962 € DL elisas bovine