| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
S100A9 Heterodimer is produced by our E, Recombinant Human S100A8 &, Thr2-Pro114(S100A9) is expressed with a 6His tag at the C-terminus, coli expression system and the target gene encoding Met1-Glu93(S100A8)& |
| Molecular Weight: |
11, 13, 2 kD, 7& |
| UniProt number: |
P06702, P05109 & |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
10%Glycerol, 150 mM sodium chloride, 2, 2 um filtered solution of 20 mM HEPES, 4, 5 mM EDTA, Supplied as a 0, pH 7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEHHHHHH&, TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
A9 Heterodimer (C-6His), S100 Calcium Binding Protein A8 |
| Short name: |
A9 Heterodimer (C-6His), Recombinant S100 Calcium Binding Protein A8 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
A9 Heterodimer (C-6His), sapiens S100 Calcium Binding Protein A8, recombinant H |
| Alternative technique: |
rec |