| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse S100 Calcium Binding Protein A8 is produced by our E, coli expression system and the target gene encoding Met1-Glu89 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
11, 3 kD |
| UniProt number: |
P27005 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of 20 mMTris，pH8, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKELEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
S100A8 (C-6His), S100 Calcium Binding Protein A8 |
| Short name: |
S100A8 (C-6His), Recombinant Mouse S100 Calcium Binding Protein A8 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
S100 calcium binding protein A8 (C-6His), recombinant Mouse S100 Calcium Binding Protein A8 |
| Alternative technique: |
rec |
| Alternative to gene target: |
60B8AG and CAGA and CFAG and CGLA and CP-10 and L1Ag and MA387 and MIF and MRP8 and NIF and P8, RAGE receptor binding, S100A8 and IDBG-102654 and ENSG00000143546 and 6279, S100A8 and IDBG-632868 and ENSBTAG00000012640 and 616818, S100a8 and IDBG-168077 and ENSMUSG00000056054 and 20201, nuclei, this GO :0001816 and cytokine production and biological process this GO :0002523 and leukocyte migration involved in inflammatory response and biological process this GO :0002526 and acute inflammatory response and biological process this GO :0002544 and chronic inflammatory response and biological process this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005829 and cytosol and cellular component this GO :0005856 and cytoskeleton and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006914 and autophagy and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006954 and inflammatory response and biological process this GO :0008017 and microtubule binding and molecular function this GO :0008270 and zinc ion binding and molecular function this GO :0010043 and response to zinc ion and biological process this GO :0030307 and positive regulation of cell growth and biological process this GO :0030593 and neutrophil chemotaxis and biological process this GO :0032119 and sequestering of zinc ion and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032602 and chemokine production and biological process this GO :0035662 and Toll-like receptor 4 binding and molecular function this GO :0042060 and wound healing and biological process this GO :0042742 and defense response to bacterium and biological process this GO :0045087 and innate immune response and biological process this GO :0045471 and response to ethanol and biological process this GO :0050544 and arachidonic acid binding and molecular function this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0050786 and RAGE receptor binding and molecular function this GO :0050832 and defense response to fungus and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0051493 and regulation of cytoskeleton organization and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070488 and neutrophil aggregation and biological process this GO :2001244 and positive regulation of intrinsic apoptotic signaling pathway and biological process, this GO :0005509 : calcium ion binding, this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0008017 : microtubule binding and also this GO :0008270 : zinc ion binding and also this GO :0035662 : Toll-like receptor 4 binding and also this GO :0050544 : arachidonic acid binding and also this GO :0050786 : RAGE receptor binding, this GO :0005515 : protein binding, this GO :0008017 : microtubule binding, this GO :0008270 : zinc ion binding, this GO :0035662 : Toll-like receptor 4 binding, this GO :0050544 : arachidonic acid binding, this GO :0050786 : RAGE receptor binding, S100 calcium binding protein A8 |
| Identity: |
10498 |
| Gene: |
S100A8 |
More about : S100A8 |
| Long gene name: |
S100 calcium binding protein A8 |
| Synonyms gene: |
CAGA CFAG |
| Synonyms gene name: |
S100 calcium-binding protein A8 (calgranulin A) S100 calcium binding protein A8 (calgranulin A) |
| Synonyms: |
P8 MRP8 60B8AG CGLA |
| Locus: |
1q21, 3 |
| Discovery year: |
1989-05-19 |
| GenBank acession: |
BC005928 |
| Entrez gene record: |
6279 |
| RefSeq identity: |
NM_002964 |
| Classification: |
S100 calcium binding proteins EF-hand domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000013124 |