Recombinant Human S100 Calcium Binding Protein A9, S100A9, MRP14

Contact us
Catalog number: C795
Price: 1022 €
Supplier: acr
Product name: Recombinant Human S100 Calcium Binding Protein A9, S100A9, MRP14
Quantity: 0,5 mg
Other quantities: 1 mg 1115€ 50 µg 156€ 500 µg 709€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human S100 Calcium Binding Protein A9 is produced by our E, coli expression system and the target gene encoding Thr2-Pro114 is expressed
Molecular Weight: 13, 2 kD
UniProt number: P06702
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: MRP14, S100A9, S100 Calcium Binding Protein A9
Short name: MRP14, S100A9, Recombinant S100 Calcium Binding Protein A9
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: MRP14, S100 calcium binding protein A9, sapiens S100 Calcium Binding Protein A9, recombinant H
Alternative technique: rec
Alternative to gene target: 60B8AG and CAGB and CFAG and CGLB and L1AG and LIAG and MAC387 and MIF and MRP14 and NIF and P14, GM5849 and IDBG-705944 and ENSMUSG00000096621 and 545541, RAGE receptor binding, S100A9 and IDBG-102644 and ENSG00000163220 and 6280, S100A9 and IDBG-632885 and ENSBTAG00000006505 and 532569, nuclei, this GO :0001816 and cytokine production and biological process this GO :0002523 and leukocyte migration involved in inflammatory response and biological process this GO :0002544 and chronic inflammatory response and biological process this GO :0004871 and signal transducer activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005829 and cytosol and cellular component this GO :0005856 and cytoskeleton and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006914 and autophagy and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006954 and inflammatory response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008017 and microtubule binding and molecular function this GO :0008270 and zinc ion binding and molecular function this GO :0010043 and response to zinc ion and biological process this GO :0016209 and antioxidant activity and molecular function this GO :0030307 and positive regulation of cell growth and biological process this GO :0030593 and neutrophil chemotaxis and biological process this GO :0030595 and leukocyte chemotaxis and biological process this GO :0031532 and actin cytoskeleton reorganization and biological process this GO :0032119 and sequestering of zinc ion and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032602 and chemokine production and biological process this GO :0035662 and Toll-like receptor 4 binding and molecular function this GO :0042742 and defense response to bacterium and biological process this GO :0045087 and innate immune response and biological process this GO :0045113 and regulation of integrin biosynthetic process and biological process this GO :0045471 and response to ethanol and biological process this GO :0050544 and arachidonic acid binding and molecular function this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0050786 and RAGE receptor binding and molecular function this GO :0050832 and defense response to fungus and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0051493 and regulation of cytoskeleton organization and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070488 and neutrophil aggregation and biological process this GO :2001244 and positive regulation of intrinsic apoptotic signaling pathway and biological process, this GO :0004871 : signal transducer activity, this GO :0004871 : signal transducer activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0008017 : microtubule binding and also this GO :0008270 : zinc ion binding and also this GO :0016209 : antioxidant activity and also this GO :0035662 : Toll-like receptor 4 binding and also this GO :0050544 : arachidonic acid binding and also this GO :0050786 : RAGE receptor binding, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0008017 : microtubule binding, this GO :0008270 : zinc ion binding, this GO :0016209 : antioxidant activity, this GO :0035662 : Toll-like receptor 4 binding, this GO :0050544 : arachidonic acid binding, this GO :0050786 : RAGE receptor binding, S100 calcium binding protein A9
Identity: 10499
Gene: S100A9 | More about : S100A9
Long gene name: S100 calcium binding protein A9
Synonyms gene: CAGB CFAG
Synonyms gene name: S100 calcium-binding protein A9 (calgranulin B) S100 calcium binding protein A9 (calgranulin B)
Synonyms: P14 MIF NIF LIAG MRP14 MAC387 60B8AG CGLB
Locus: 1q21, 3
Discovery year: 1989-05-19
GenBank acession: BC047681
Entrez gene record: 6280
RefSeq identity: NM_002965
Classification: S100 calcium binding proteins EF-hand domain containing
Havana BLAST/BLAT: OTTHUMG00000013125

Related Products :

C795 Recombinant Human S100 Calcium Binding Protein A9, S100A9, MRP14 10 µg 100 € novo human
MBS613298 CABP9K (CALB3, CABP1, S100G, S100 calcium binding protein G, CABP, Calbindin-D9k, MGC138379, Protein S100-G, S100 calcium-binding protein G, S100D, Vitamin D-dependent calcium-binding protein, intestinal) Antibody 0.05 ml 442 € MBS Polyclonals_1 human
AE20889HU-48 ELISA test for Human S100 calcium binding protein A9/calgranulin B (S100A9) 1x plate of 48 wells 373 € abebio human
AE20889HU Human S100 calcium binding protein A9/calgranulin B (S100A9) ELISA Kit 96 wells plate 769 € ab-elisa elisas human
AE20889HU-96 Human S100 calcium binding protein A9/calgranulin B (S100A9) ELISA Kit 1x plate of 96 wells 612 € abebio human
DL-S100A9-Hu Human S100 Calcium Binding Protein A9 S100A9 ELISA Kit 96T 869 € DL elisas human
GENTAUR-58bdc34263554 Anti- S100 Calcium Binding Protein A9 (S100A9) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdc412b050d Anti- S100 Calcium Binding Protein A9 (S100A9) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdc41307401 Anti- S100 Calcium Binding Protein A9 (S100A9) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdc69231c77 Anti- S100 Calcium Binding Protein A9 (S100A9) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc69280965 Anti- S100 Calcium Binding Protein A9 (S100A9) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc91c5a7d7 Anti- S100 Calcium Binding Protein A9 (S100A9) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc91cd0359 Anti- S100 Calcium Binding Protein A9 (S100A9) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdcb26784df Anti- S100 Calcium Binding Protein A9 (S100A9) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdcdf6a2fae Anti- S100 Calcium Binding Protein A9 (S100A9) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd43a4cfbd Anti- S100 Calcium Binding Protein A9 (S100A9) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bdd744caf6e Anti- S100 Calcium Binding Protein A9 (S100A9) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bdd86e840f9 Anti- S100 Calcium Binding Protein A9 (S100A9) Antibody 100ug 542 € MBS Polyclonals human
DL-S100A9-b Bovine S100 Calcium Binding Protein A9 S100A9 ELISA Kit 96T 1020 € DL elisas bovine
DL-S100A9-Mu Mouse S100 Calcium Binding Protein A9 S100A9 ELISA Kit 96T 904 € DL elisas mouse
EKU07181 S100 Calcium Binding Protein A9 (S100A9) ELISA kit 1 plate of 96 wells 930 € Biomatik ELISA kits human
EKU07182 S100 Calcium Binding Protein A9 (S100A9) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU07183 S100 Calcium Binding Protein A9 (S100A9) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
C258 Recombinant Human S100 Calcium Binding Protein P, S100-P (N-6His) 50 µg 496 € novo human
MBS243432 Anti-Human S100A9 / MRP14 Antibody 100ul 597 € MBS Polyclonals_1 human
MBS242631 Goat Polyclonal to Human S100A9 / MRP14 Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58bde6e025266 Mouse Monoclonal [clone 47-8D3] (IgG1) to Human S100A9 / MRP14 Antibody 50ug 597 € MBS mono human
AR39060PU-L anti-S100A9 / Calgranulin-B / MRP14 (1-113, His-tag) Antibody 0,25 mg 1500 € acr human
AR39060PU-N anti-S100A9 / Calgranulin-B / MRP14 (1-113, His-tag) Antibody 50 Вµg 587 € acr human
AR09453PU-L anti-S100A9 / Calgranulin-B / MRP14 (1-114, His-tag) Antibody 0,5 mg 1022 € acr human