| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human S100 Calcium Binding Protein A9 is produced by our E, coli expression system and the target gene encoding Thr2-Pro114 is expressed |
| Molecular Weight: |
13, 2 kD |
| UniProt number: |
P06702 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
MRP14, S100A9, S100 Calcium Binding Protein A9 |
| Short name: |
MRP14, S100A9, Recombinant S100 Calcium Binding Protein A9 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
MRP14, S100 calcium binding protein A9, sapiens S100 Calcium Binding Protein A9, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
60B8AG and CAGB and CFAG and CGLB and L1AG and LIAG and MAC387 and MIF and MRP14 and NIF and P14, GM5849 and IDBG-705944 and ENSMUSG00000096621 and 545541, RAGE receptor binding, S100A9 and IDBG-102644 and ENSG00000163220 and 6280, S100A9 and IDBG-632885 and ENSBTAG00000006505 and 532569, nuclei, this GO :0001816 and cytokine production and biological process this GO :0002523 and leukocyte migration involved in inflammatory response and biological process this GO :0002544 and chronic inflammatory response and biological process this GO :0004871 and signal transducer activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005829 and cytosol and cellular component this GO :0005856 and cytoskeleton and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006914 and autophagy and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006954 and inflammatory response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008017 and microtubule binding and molecular function this GO :0008270 and zinc ion binding and molecular function this GO :0010043 and response to zinc ion and biological process this GO :0016209 and antioxidant activity and molecular function this GO :0030307 and positive regulation of cell growth and biological process this GO :0030593 and neutrophil chemotaxis and biological process this GO :0030595 and leukocyte chemotaxis and biological process this GO :0031532 and actin cytoskeleton reorganization and biological process this GO :0032119 and sequestering of zinc ion and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032602 and chemokine production and biological process this GO :0035662 and Toll-like receptor 4 binding and molecular function this GO :0042742 and defense response to bacterium and biological process this GO :0045087 and innate immune response and biological process this GO :0045113 and regulation of integrin biosynthetic process and biological process this GO :0045471 and response to ethanol and biological process this GO :0050544 and arachidonic acid binding and molecular function this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0050786 and RAGE receptor binding and molecular function this GO :0050832 and defense response to fungus and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0051493 and regulation of cytoskeleton organization and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070488 and neutrophil aggregation and biological process this GO :2001244 and positive regulation of intrinsic apoptotic signaling pathway and biological process, this GO :0004871 : signal transducer activity, this GO :0004871 : signal transducer activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0008017 : microtubule binding and also this GO :0008270 : zinc ion binding and also this GO :0016209 : antioxidant activity and also this GO :0035662 : Toll-like receptor 4 binding and also this GO :0050544 : arachidonic acid binding and also this GO :0050786 : RAGE receptor binding, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0008017 : microtubule binding, this GO :0008270 : zinc ion binding, this GO :0016209 : antioxidant activity, this GO :0035662 : Toll-like receptor 4 binding, this GO :0050544 : arachidonic acid binding, this GO :0050786 : RAGE receptor binding, S100 calcium binding protein A9 |
| Identity: |
10499 |
| Gene: |
S100A9 |
More about : S100A9 |
| Long gene name: |
S100 calcium binding protein A9 |
| Synonyms gene: |
CAGB CFAG |
| Synonyms gene name: |
S100 calcium-binding protein A9 (calgranulin B) S100 calcium binding protein A9 (calgranulin B) |
| Synonyms: |
P14 MIF NIF LIAG MRP14 MAC387 60B8AG CGLB |
| Locus: |
1q21, 3 |
| Discovery year: |
1989-05-19 |
| GenBank acession: |
BC047681 |
| Entrez gene record: |
6280 |
| RefSeq identity: |
NM_002965 |
| Classification: |
S100 calcium binding proteins EF-hand domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000013125 |