Recombinant Mouse β-Nerve Growth Factor, β-NGF (Met130-Arg239)

Contact us
Catalog number: C793
Price: 360 €
Supplier: abebio
Product name: Recombinant Mouse β-Nerve Growth Factor, β-NGF (Met130-Arg239)
Quantity: 1x plate of 48 wells
Other quantities: 10 µg 100€ 50 µg 156€ 500 µg 709€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse beta-Nerve Growth Factor is produced by our E, coli expression system and the target gene encoding Met130-Arg239 is expressed
Molecular Weight: 12, 4 kD
UniProt number: P01139
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 20 mM Tris, 200 mM sodium chloride, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: &beta, &beta, -NGF (Met130-Arg239), -Nerve Growth Factor
Short name: &beta, -NGF (Met130-Arg239), -Nerve Growth Factor, Recombinant Mouse &beta
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses
Alternative name: &beta, -Nerve Growth Factor, -nerve growth factor (beta polypeptide) (Met130-Arg239), recombinant Mouse &beta
Alternative technique: rec
Alternative to gene target: Beta-NGF and HSAN5 and NGFB, Extracellular, NGF and IDBG-101347 and ENSG00000134259 and 4803, NGF and IDBG-648895 and ENSBTAG00000007446 and 281350, Ngf and IDBG-180362 and ENSMUSG00000027859 and 18049, growth factor activity, this GO :0000186 and activation of MAPKK activity and biological process this GO :0005057 and receptor signaling protein activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005163 and nerve growth factor receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005768 and endosome and cellular component this GO :0005796 and this GO lgi lumen and cellular component this GO :0006954 and inflammatory response and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007202 and activation of phospholipase C activity and biological process this GO :0007264 and small GTPase mediated signal transduction and biological process this GO :0007265 and Ras protein signal transduction and biological process this GO :0007422 and peripheral nervous system development and biological process this GO :0007613 and memory and biological process this GO :0007623 and circadian rhythm and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008344 and adult locomotory behavior and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0009314 and response to radiation and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0010033 and response to organic substance and biological process this GO :0010193 and response to ozone and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010976 and positive regulation of neuron projection development and biological process this GO :0014042 and positive regulation of neuron maturation and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0019233 and sensory perception of pain and biological process this GO :0030307 and positive regulation of cell growth and biological process this GO :0031175 and neuron projection development and biological process this GO :0031954 and positive regulation of protein autophosphorylation and biological process this GO :0032455 and nerve growth factor processing and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0035094 and response to nicotine and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0042493 and response to drug and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043281 and regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043434 and response to peptide hormone and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0045664 and regulation of neuron differentiation and biological process this GO :0045666 and positive regulation of neuron differentiation and biological process this GO :0045773 and positive regulation of axon extension and biological process this GO :0045786 and negative regulation of cell cycle and biological process this GO :0046928 and regulation of neurotransmitter secretion and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048812 and neuron projection morphogenesis and biological process this GO :0050770 and regulation of axonogenesis and biological process this GO :0050772 and positive regulation of axonogenesis and biological process this GO :0051091 and positive regulation of sequence-specific DNA binding transcription factor activity and biological process this GO :0051384 and response to glucocorticoid and biological process this GO :0051388 and positive regulation of nerve growth factor receptor signaling pathway and biological process this GO :0051402 and neuron apoptotic process and biological process this GO :0051602 and response to electrical stimulus and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :0097192 and extrinsic apoptotic signaling pathway in absence of ligand and biological process this GO :2000648 and positive regulation of stem cell proliferation and biological process this GO :2000675 and negative regulation of type B pancreatic cell apoptotic process and biological process, this GO :0005057 : receptor signaling protein activity, this GO :0005057 : receptor signaling protein activity and also this GO :0005102 : receptor binding and also this GO :0005163 : nerve growth factor receptor binding and also this GO :0008083 : growth factor activity, this GO :0005102 : receptor binding, this GO :0005163 : nerve growth factor receptor binding, this GO :0008083 : growth factor activity, nerve growth factor (beta polypeptide)

Related Products :

MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
C793 Recombinant Mouse β-Nerve Growth Factor, β-NGF (Met130-Arg239) 1 mg 1115 € novo human
CI51 Recombinant Human β-Nerve Growth Factor, β-NGF (Ser122-Arg239, Human Cells) 1 mg 1014 € novo human
MBS612244 Nerve Growth Factor Receptor, p75 (NGFR, NGF Receptor, CD271, Gp80 LNGFR, Low Affinity Nerve Growth Factor Receptor, Low Affinity Neurotrophin Receptor p75 NTR, p75 ICD, p75 Neurotrophin, p75 NTR, Tumor Necrosis Factor Receptor Superfamily Member 16, TNFR Antibody 100ug 591 € MBS Polyclonals_1 human
CK21 Recombinant Mouse β-Nerve Growth Factor, β-NGF (Ser122-Gly241) 500 µg 1186 € novo human
C060 Recombinant Human β-Nerve Growth Factor, β-NGF (Ser122-Ala241, E. coli) 500 µg 1186 € novo human
C078 Recombinant Human pro-Nerve Growth Factor, pro-NGF (Glu19-Ala241) 1 mg 2283 € novo human
AE31079GU-48 ELISA test for Guinea pig Beta-nerve growth factor (NGF) 1x plate of 48 wells 402 € abebio human
AE31079GU Guinea pig Beta-nerve growth factor (NGF) ELISA Kit 96 wells plate 810 € ab-elisa elisas human
AE31079GU-96 Guinea pig Beta-nerve growth factor (NGF) ELISA Kit 1x plate of 96 wells 671 € abebio human
GENTAUR-58bcd3786b060 Praomys natalensis Beta-nerve growth factor (NGF) 100ug 1420 € MBS Recombinant Proteins human
GENTAUR-58bcd378b7c47 Praomys natalensis Beta-nerve growth factor (NGF) 1000ug 1420 € MBS Recombinant Proteins human
GENTAUR-58bcd37914c18 Praomys natalensis Beta-nerve growth factor (NGF) 100ug 1923 € MBS Recombinant Proteins human
GENTAUR-58bcd3794d8c7 Praomys natalensis Beta-nerve growth factor (NGF) 1000ug 1923 € MBS Recombinant Proteins human
abx575475 Anti-Mouse Nerve Growth Factor (NGF) ELISA Kit inquire 50 € abbex mouse
DL-NGF-Mu Mouse Nerve Growth Factor NGF ELISA Kit 96T 730 € DL elisas mouse
abx575528 Anti-Chicken Nerve Growth Factor (NGF) ELISA Kit 96 tests 702 € abbex chicken
abx574337 Anti-Cow Nerve Growth Factor (NGF) ELISA Kit 96 tests 760 € abbex cow
abx570467 Anti-Guinea pig Nerve Growth Factor (NGF) ELISA Kit inquire 50 € abbex human
abx574571 Anti-Human Nerve Growth Factor (NGF) ELISA Kit inquire 50 € abbex human
abx574731 Anti-Monkey Nerve Growth Factor (NGF) ELISA Kit inquire 50 € abbex monkey
GENTAUR-58bdcbe2b2ded Anti- Nerve Growth Factor (NGF) Antibody 100ug 409 € MBS Polyclonals human
GENTAUR-58bdcbe31be50 Anti- Nerve Growth Factor (NGF) Antibody 50ug 332 € MBS Polyclonals human
GENTAUR-58bdcd2c8fdfd Anti- Nerve Growth Factor (NGF) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bddc1e96055 Anti- Nerve Growth Factor (NGF) Antibody 100ug 520 € MBS Polyclonals human
abx572272 Anti-Pig Nerve Growth Factor (NGF) ELISA Kit 96 tests 760 € abbex pig
abx575743 Anti-Rat Nerve Growth Factor (NGF) ELISA Kit 96 tests 644 € abbex rat
DL-NGF-b Bovine Nerve Growth Factor NGF ELISA Kit 96T 869 € DL elisas bovine
DL-NGF-Ch Chicken Nerve Growth Factor NGF ELISA Kit 96T 788 € DL elisas chicken
AE31077HU-48 ELISA test for Human Nerve growth factor (NGF) 1x plate of 48 wells 360 € abebio human