| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human pro-Nerve Growth Factor is produced by our E, coli expression system and the target gene encoding Glu19-Ala241 is expressed |
| Molecular Weight: |
25 kD |
| UniProt number: |
P01138 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
250 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
pro-NGF (Glu19-Ala241), pro-Nerve Growth Factor |
| Short name: |
pro-NGF (Glu19-Ala241), Recombinant pro-Nerve Growth Factor |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
L-proline-nerve growth factor (beta polypeptide) (Glu19-Ala241), sapiens L-proline-Nerve Growth Factor, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Beta-NGF and HSAN5 and NGFB, Extracellular, NGF and IDBG-101347 and ENSG00000134259 and 4803, NGF and IDBG-648895 and ENSBTAG00000007446 and 281350, Ngf and IDBG-180362 and ENSMUSG00000027859 and 18049, growth factor activity, this GO :0000186 and activation of MAPKK activity and biological process this GO :0005057 and receptor signaling protein activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005163 and nerve growth factor receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005768 and endosome and cellular component this GO :0005796 and this GO lgi lumen and cellular component this GO :0006954 and inflammatory response and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007202 and activation of phospholipase C activity and biological process this GO :0007264 and small GTPase mediated signal transduction and biological process this GO :0007265 and Ras protein signal transduction and biological process this GO :0007422 and peripheral nervous system development and biological process this GO :0007613 and memory and biological process this GO :0007623 and circadian rhythm and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008344 and adult locomotory behavior and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0009314 and response to radiation and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0010033 and response to organic substance and biological process this GO :0010193 and response to ozone and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010976 and positive regulation of neuron projection development and biological process this GO :0014042 and positive regulation of neuron maturation and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0019233 and sensory perception of pain and biological process this GO :0030307 and positive regulation of cell growth and biological process this GO :0031175 and neuron projection development and biological process this GO :0031954 and positive regulation of protein autophosphorylation and biological process this GO :0032455 and nerve growth factor processing and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0035094 and response to nicotine and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0042493 and response to drug and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043281 and regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043434 and response to peptide hormone and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0045664 and regulation of neuron differentiation and biological process this GO :0045666 and positive regulation of neuron differentiation and biological process this GO :0045773 and positive regulation of axon extension and biological process this GO :0045786 and negative regulation of cell cycle and biological process this GO :0046928 and regulation of neurotransmitter secretion and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048812 and neuron projection morphogenesis and biological process this GO :0050770 and regulation of axonogenesis and biological process this GO :0050772 and positive regulation of axonogenesis and biological process this GO :0051091 and positive regulation of sequence-specific DNA binding transcription factor activity and biological process this GO :0051384 and response to glucocorticoid and biological process this GO :0051388 and positive regulation of nerve growth factor receptor signaling pathway and biological process this GO :0051402 and neuron apoptotic process and biological process this GO :0051602 and response to electrical stimulus and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :0097192 and extrinsic apoptotic signaling pathway in absence of ligand and biological process this GO :2000648 and positive regulation of stem cell proliferation and biological process this GO :2000675 and negative regulation of type B pancreatic cell apoptotic process and biological process, this GO :0005057 : receptor signaling protein activity, this GO :0005057 : receptor signaling protein activity and also this GO :0005102 : receptor binding and also this GO :0005163 : nerve growth factor receptor binding and also this GO :0008083 : growth factor activity, this GO :0005102 : receptor binding, this GO :0005163 : nerve growth factor receptor binding, this GO :0008083 : growth factor activity, nerve growth factor (beta polypeptide) |
| Identity: |
7808 |
| Gene: |
NGF |
More about : NGF |
| Long gene name: |
nerve growth factor |
| Synonyms gene: |
NGFB |
| Synonyms gene name: |
nerve growth factor (beta polypeptide) |
| Locus: |
1p13, 2 |
| Discovery year: |
2001-06-22 |
| Entrez gene record: |
4803 |
| RefSeq identity: |
NM_002506 |
| Classification: |
Endogenous ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000011880 |
| Locus Specific Databases: |
Inherited Peripheral Neuropathies Mutation Database LRG_260 |