Recombinant Human Integral Membrane Protein 2B, ITM2B, imBRI2 (C-6His)

Contact us
Catalog number: C679
Price: 2078 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Integral Membrane Protein 2B, ITM2B, imBRI2 (C-6His)
Quantity: 1000ug
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Integral Membrane Protein 2B is produced by our Mammalian expression system and the target gene encoding Tyr76-Ser266 is expressed with a 6His tag at the C-terminus
Molecular Weight: 23, 3 kD
UniProt number: Q9Y287
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: YKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICSVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ITM2B, imBRI2 (C-6His), Integral Membrane Protein 2B
Short name: ITM2B, imBRI2 (C-6His), Recombinant Integral Membrane Protein 2B
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: imBRI2 (C-6His), integral membrane protein 2B, sapiens Integral Membrane Protein 2B, recombinant H
Alternative technique: rec
Alternative to gene target: ABRI and BRI and BRI2 and BRICD2B and E25B and E3-16 and FBD and imBRI2, ATP binding, Extracellular, ITM2B and IDBG-31933 and ENSG00000136156 and 9445, ITM2B and IDBG-629079 and ENSBTAG00000003109 and 510575, Itm2b and IDBG-180024 and ENSMUSG00000022108 and 16432, this GO :0001540 and beta-amyloid binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0007399 and nervous system development and biological process this GO :0010008 and endosome membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0030660 and this GO lgi-associated vesicle membrane and cellular component this GO :0031301 and integral component of organelle membrane and cellular component this GO :0042985 and negative regulation of amyloid precursor protein biosynthetic process and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0097192 and extrinsic apoptotic signaling pathway in absence of ligand and biological process, this GO :0001540 : beta-amyloid binding, this GO :0001540 : beta-amyloid binding and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, integral membrane protein 2B
Identity: 6174
Gene: ITM2B | More about : ITM2B
Long gene name: integral membrane protein 2B
Synonyms: BRI E25B E3-16 BRICD2B BRI2
Synonyms name: BRICHOS domain containing 2B
Locus: 13q14, 2
Discovery year: 1999-04-15
GenBank acession: AF092128
Entrez gene record: 9445
Pubmed identfication: 9795190
RefSeq identity: NM_021999
Classification: BRICHOS domain containing
Havana BLAST/BLAT: OTTHUMG00000016894

Related Products :

C679 Recombinant Human Integral Membrane Protein 2B, ITM2B, imBRI2 (C-6His) 1 mg 2283 € novo human
GENTAUR-58b8d6016bc96 Chicken Integral membrane protein 2B (ITM2B) 100ug 1238 € MBS Recombinant Proteins chicken
GENTAUR-58b8d601db67b Chicken Integral membrane protein 2B (ITM2B) 1000ug 1238 € MBS Recombinant Proteins chicken
GENTAUR-58b8d6022e87e Chicken Integral membrane protein 2B (ITM2B) 100ug 1741 € MBS Recombinant Proteins chicken
GENTAUR-58b8d60293ba2 Chicken Integral membrane protein 2B (ITM2B) 1000ug 1741 € MBS Recombinant Proteins chicken
GENTAUR-58b9d1f0ca57a Chicken Integral membrane protein 2B (ITM2B) 100ug 1238 € MBS Recombinant Proteins chicken
GENTAUR-58b9d1f1384a6 Chicken Integral membrane protein 2B (ITM2B) 1000ug 1238 € MBS Recombinant Proteins chicken
GENTAUR-58b9d1f1a0ae6 Chicken Integral membrane protein 2B (ITM2B) 100ug 1741 € MBS Recombinant Proteins chicken
GENTAUR-58b9d1f214ae3 Chicken Integral membrane protein 2B (ITM2B) 1000ug 1741 € MBS Recombinant Proteins chicken
AE37600PI-48 ELISA test for Pig Integral membrane protein 2B (ITM2B) 1x plate of 48 wells 402 € abebio pig
MBS612937 Integral Membrane Protein 2B (ITM2B, BRICHOS Domain Containing 2B) 50ug 625 € MBS Polyclonals_1 human
GENTAUR-58bc5ab298074 Pan troglodytes Integral membrane protein 2B (ITM2B) 100ug 1249 € MBS Recombinant Proteins human
GENTAUR-58bc5ab2e96d5 Pan troglodytes Integral membrane protein 2B (ITM2B) 1000ug 1249 € MBS Recombinant Proteins human
GENTAUR-58bc5ab3403f6 Pan troglodytes Integral membrane protein 2B (ITM2B) 100ug 1752 € MBS Recombinant Proteins human
GENTAUR-58bc5ab394a01 Pan troglodytes Integral membrane protein 2B (ITM2B) 1000ug 1752 € MBS Recombinant Proteins human
AE37600PI-96 Pig Integral membrane protein 2B (ITM2B) ELISA Kit 1x plate of 96 wells 671 € abebio pig
CP46 Recombinant Human NKG2-D type II Integral Membrane Protein, NKG2D, CD314 (N-6His) 10 µg 146 € novo human
MBS611922 LIMPII (Lysosomal Integral Membrane Protein II, 85kD Lysosomal Membrane Sialoglycoprotein, 85kD Lysosomal Sialoglycoprotein Scavenger Receptor Class B Member 2, CD36 Antigen (Collagen Type I Receptor Thrombospondin Receptor)-like 2, Lysosome Membrane Prot Antibody 100ul 630 € MBS Polyclonals_1 human
CB20 Recombinant Human NKG2-A, NKG2-B Type II Integral Membrane Protein(N-8His) 50 µg 141 € novo human
MBS244607 Goat Polyclonal to Human ABRI / ITM2B Antibody 50ug 597 € MBS Polyclonals_1 human
LV193185 ITM2B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV193186 ITM2B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV193187 ITM2B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV193188 ITM2B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV193190 ITM2B Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV193189 ITM2B Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
abx253905 Anti-Human Vesicular integral-membrane protein VIP36 ELISA Kit 96 tests 659 € abbex human
AE41605HU-48 ELISA test for Human Golgi integral membrane protein 4 (GOLIM4) 1x plate of 48 wells 373 € abebio human
GENTAUR-58bcd171e97c2 Human Golgi integral membrane protein 4 (GOLIM4) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bcd17231426 Human Golgi integral membrane protein 4 (GOLIM4) 1000ug 2078 € MBS Recombinant Proteins human