| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Integral Membrane Protein 2B is produced by our Mammalian expression system and the target gene encoding Tyr76-Ser266 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
23, 3 kD |
| UniProt number: |
Q9Y287 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
YKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICSVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
ITM2B, imBRI2 (C-6His), Integral Membrane Protein 2B |
| Short name: |
ITM2B, imBRI2 (C-6His), Recombinant Integral Membrane Protein 2B |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
imBRI2 (C-6His), integral membrane protein 2B, sapiens Integral Membrane Protein 2B, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ABRI and BRI and BRI2 and BRICD2B and E25B and E3-16 and FBD and imBRI2, ATP binding, Extracellular, ITM2B and IDBG-31933 and ENSG00000136156 and 9445, ITM2B and IDBG-629079 and ENSBTAG00000003109 and 510575, Itm2b and IDBG-180024 and ENSMUSG00000022108 and 16432, this GO :0001540 and beta-amyloid binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0007399 and nervous system development and biological process this GO :0010008 and endosome membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0030660 and this GO lgi-associated vesicle membrane and cellular component this GO :0031301 and integral component of organelle membrane and cellular component this GO :0042985 and negative regulation of amyloid precursor protein biosynthetic process and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0097192 and extrinsic apoptotic signaling pathway in absence of ligand and biological process, this GO :0001540 : beta-amyloid binding, this GO :0001540 : beta-amyloid binding and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, integral membrane protein 2B |
| Identity: |
6174 |
| Gene: |
ITM2B |
More about : ITM2B |
| Long gene name: |
integral membrane protein 2B |
| Synonyms: |
BRI E25B E3-16 BRICD2B BRI2 |
| Synonyms name: |
BRICHOS domain containing 2B |
| Locus: |
13q14, 2 |
| Discovery year: |
1999-04-15 |
| GenBank acession: |
AF092128 |
| Entrez gene record: |
9445 |
| Pubmed identfication: |
9795190 |
| RefSeq identity: |
NM_021999 |
| Classification: |
BRICHOS domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000016894 |