| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human CD157 is produced by our Mammalian expression system and the target gene encoding Gly29-Lys292 is expressed with a 6His at the C-terminus |
| Molecular Weight: |
30, 8 kD |
| UniProt number: |
Q10588 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
BST1 (C-6His), CD157 |
| Short name: |
BST1 (C-6His), Recombinant CD157 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
bone marrow stromal cell antigen 1 (C-6His), sapiens CD157, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BST1 and IDBG-10614 and ENSG00000109743 and 683, BST1 and IDBG-643978 and ENSBTAG00000006156 and 616757, Bst1 and IDBG-161385 and ENSMUSG00000029082 and 12182, CD157, NAD(P)+ nucleosidase activity, Plasma membranes, this GO :0003953 and NAD+ nucleosidase activity and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006959 and humoral immune response and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0008152 and metabolic process and biological process this GO :0016740 and transferase activity and molecular function this GO :0019898 and extrinsic component of membrane and cellular component this GO :0031225 and anchored component of membrane and cellular component this GO :0050135 and NAD(P)+ nucleosidase activity and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003953 : NAD+ nucleosidase activity, this GO :0003953 : NAD+ nucleosidase activity and also this GO :0016740 : transferase activity and also this GO :0050135 : NAD(P)+ nucleosidase activity, this GO :0016740 : transferase activity, this GO :0050135 : NAD(P)+ nucleosidase activity, bone marrow stromal cell antigen 1 |
| Identity: |
1118 |
| Gene: |
BST1 |
More about : BST1 |
| Long gene name: |
bone marrow stromal cell antigen 1 |
| Synonyms: |
CD157 |
| Synonyms name: |
NAD(+) nucleosidase ADP-ribosyl cyclase 2 |
| Locus: |
4p15, 32 |
| Discovery year: |
1994-11-17 |
| GenBank acession: |
D21878 |
| Entrez gene record: |
683 |
| Pubmed identfication: |
8202488 |
| RefSeq identity: |
NM_004334 |
| Classification: |
CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000097739 |