Recombinant Human CD157, BST1 (C-6His)

Contact us
Catalog number: C663
Price: Ask price €
Supplier: accurate-monoclonals
Product name: Recombinant Human CD157, BST1 (C-6His)
Quantity: 50 ug
Other quantities: 1 mg 1318€ 10 µg 126€ 50 µg 278€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CD157 is produced by our Mammalian expression system and the target gene encoding Gly29-Lys292 is expressed with a 6His at the C-terminus
Molecular Weight: 30, 8 kD
UniProt number: Q10588
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: BST1 (C-6His), CD157
Short name: BST1 (C-6His), Recombinant CD157
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: bone marrow stromal cell antigen 1 (C-6His), sapiens CD157, recombinant H
Alternative technique: rec
Alternative to gene target: BST1 and IDBG-10614 and ENSG00000109743 and 683, BST1 and IDBG-643978 and ENSBTAG00000006156 and 616757, Bst1 and IDBG-161385 and ENSMUSG00000029082 and 12182, CD157, NAD(P)+ nucleosidase activity, Plasma membranes, this GO :0003953 and NAD+ nucleosidase activity and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006959 and humoral immune response and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0008152 and metabolic process and biological process this GO :0016740 and transferase activity and molecular function this GO :0019898 and extrinsic component of membrane and cellular component this GO :0031225 and anchored component of membrane and cellular component this GO :0050135 and NAD(P)+ nucleosidase activity and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003953 : NAD+ nucleosidase activity, this GO :0003953 : NAD+ nucleosidase activity and also this GO :0016740 : transferase activity and also this GO :0050135 : NAD(P)+ nucleosidase activity, this GO :0016740 : transferase activity, this GO :0050135 : NAD(P)+ nucleosidase activity, bone marrow stromal cell antigen 1
Identity: 1118
Gene: BST1 | More about : BST1
Long gene name: bone marrow stromal cell antigen 1
Synonyms: CD157
Synonyms name: NAD(+) nucleosidase ADP-ribosyl cyclase 2
Locus: 4p15, 32
Discovery year: 1994-11-17
GenBank acession: D21878
Entrez gene record: 683
Pubmed identfication: 8202488
RefSeq identity: NM_004334
Classification: CD molecules
Havana BLAST/BLAT: OTTHUMG00000097739

Related Products :

MBS620547 CD157 (BST1, bone marrow stromal cell antigen 1, ADP-ribosyl cyclase 2 precursor, Bone marrow stromal antigen 1, BST-1, cADPr hydrolase 2, CD157 antigen, Cyclic ADP-ribose hydrolase 2) (Biotin) 50ug 818 € MBS Polyclonals_1 human
C663 Recombinant Human CD157, BST1 (C-6His) 1 mg 1318 € novo human
RP-0270H Recombinant Human CD157 / BST1 Protein (His Tag) 50μg 624 € adv human
RP-1096M Recombinant Mouse CD157 / BST1 Protein (His Tag) 50μg 624 € adv mouse
RP-2039R Recombinant Rat CD157 / BST1 Protein (Fc Tag) 50μg 624 € adv rat
RP-2038R Recombinant Rat CD157 / BST1 Protein (His Tag) 50μg 624 € adv rat
GENTAUR-58be2696f1488 Anti-Mouse CD157 (CD157), FITC, (clone KT157), (Rat IgG2c) 100ug 321 € MBS mono rat
AM26424FC-N anti-CD157 / BST1 Antibody 50 Tests 572 € acr human
AM26424PU-N anti-CD157 / BST1 Antibody 0,1 mg 601 € acr human
AM26424RP-N anti-CD157 / BST1 Antibody 50 Tests 572 € acr human
AM26780FC-N anti-CD157 / BST1 Antibody 100 Tests 471 € acr human
AM26780PU-N anti-CD157 / BST1 Antibody 0,1 mg 355 € acr human
AM26780RP-N anti-CD157 / BST1 Antibody 100 Tests 471 € acr human
AM31882PU-N anti-CD157 / BST1 Antibody 0,25 mg 601 € acr human
AP09922PU-N anti-CD157 / BST1 Antibody 0,1 mg 659 € acr human
C14339-1 anti-CD157 / BST1 Antibody 50 Вµg 347 € acr human
C14339-2 anti-CD157 / BST1 Antibody 0,1 mg 500 € acr human
CPA1111-100ul anti-CD157 / BST1 Antibody 0,1 ml 442 € acr human
CPA1111-200ul anti-CD157 / BST1 Antibody 0,2 ml 688 € acr human
CPA1111-30ul anti-CD157 / BST1 Antibody 30 Вµl 326 € acr human
abx139076 Anti-CD157 Antibody 0.1 mg 340 € abbex human
abx140199 Anti-CD157 Antibody (APC) 100 tests 470 € abbex human
abx139077 Anti-CD157 Antibody (PE) 100 tests 470 € abbex human
abx200634 Anti-CD157/ CD45/ CD64 (HPN) Antibody (PE, PerCP, APC) inquire 50 € abbex human
abx200635 Anti-CD157/ CD45/ CD64 (HPN) Antibody (PE, PerCP, APC) inquire 50 € abbex human
abx290005 Anti-CD157/ CD45/ CD64 (HPN) Kit 50 tests 1123 € abbex human
GENTAUR-58be25a151df7 Anti-Mouse CD157, Purified (Clone KT157) (Rat IgG2c) 0.25 miligrams 370 € MBS mono rat
ACL8984AP CD157, Rat Mouse Monoclonal antibody-Mouse; Clone: KT157 0.25mg 296 € accurate-monoclonals mouse
ACL8984F CD157, Rat Mouse Monoclonal antibody-Mouse; Clone: KT157, FITC conj. 0.1mg 229 € accurate-monoclonals mouse
ACL8984PE CD157, Rat Mouse Monoclonal antibody-Mouse; Clone: KT157, PE 50 ug Ask price € accurate-monoclonals mouse