| Catalog number: | C646 |
|---|---|
| Price: | 1613 € |
| Supplier: | novo |
| Product name: | Recombinant Human THSD1, TMTSP (C-6His) |
| Quantity: | 500 µg |
| Other quantities: | 1 mg 1166€ 10 µg 90€ 50 µg 171€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human THSD1 is produced by our Mammalian expression system and the target gene encoding Glu25-Ile361 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: | 38, 83 kD |
| UniProt number: | Q9NS62 |
| State of the product: | Freeze-dried |
| Shipping conditions: | Ambient temperature |
| Formulation: | 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNIVDHHHHHH |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | TMTSP (C-6His), THSD1 |
| Short name: | TMTSP (C-6His), Recombinant THSD1 |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | TMTSP (C-6His), sapiens THSD1, recombinant H |
| Alternative technique: | rec |
| Identity: | 17754 |
| Gene: | THSD1 | More about : THSD1 |
| Long gene name: | thrombospondin type 1 domain containing 1 |
| Synonyms gene name: | domain 1 , thrombospondin, type I |
| Synonyms: | TMTSP |
| Locus: | 13q14, 3 |
| Discovery year: | 2003-01-24 |
| GenBank acession: | AK096289 |
| Entrez gene record: | 55901 |
| Havana BLAST/BLAT: | OTTHUMG00000016963 |
| C646 | Recombinant Human THSD1, TMTSP (C-6His) | 10 µg | 90 € | novo | human |
| RP-1546M | Recombinant Mouse THSD1 / TMTSP Protein (His Tag) | 50μg | 624 € | adv | mouse |
| MBS274842 | TMTSP antibody [N3C2], Internal | 100ul | 426 € | MBS Polyclonals_1 | human |
| LV334368 | THSD1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| GENTAUR-58be655a34252 | Anti-THSD1 (Polyclonal), ALEXA Fluor 594 | 100 microliters | 489 € | Bioss Polyclonal Antibodies | human |
| abx936729 | Anti-THSD1 siRNA | inquire | 50 € | abbex | human |
| abx936730 | Anti-THSD1 siRNA | 15 nmol | 528 € | abbex | human |
| GENTAUR-58bd7a8a37d67 | Pongo abelii Thrombospondin type-1 domain-containing protein 1 (THSD1) | 100ug | 2100 € | MBS Recombinant Proteins | human |
| GENTAUR-58bd7a8a875e1 | Pongo abelii Thrombospondin type-1 domain-containing protein 1 (THSD1) | 1000ug | 2100 € | MBS Recombinant Proteins | human |
| GENTAUR-58bd7a8ad817d | Pongo abelii Thrombospondin type-1 domain-containing protein 1 (THSD1) | 100ug | 2614 € | MBS Recombinant Proteins | human |
| GENTAUR-58bd7a8b28d73 | Pongo abelii Thrombospondin type-1 domain-containing protein 1 (THSD1) | 1000ug | 2614 € | MBS Recombinant Proteins | human |
| bs-7508R-A350 | THSD1 Antibody, ALEXA FLUOR 350 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-7508R-A488 | THSD1 Antibody, ALEXA FLUOR 488 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-7508R-A555 | THSD1 Antibody, ALEXA FLUOR 555 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-7508R-A594 | THSD1 Antibody, ALEXA FLUOR 594 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-7508R-A647 | THSD1 Antibody, ALEXA FLUOR 647 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-7508R-Biotin | THSD1 Antibody, Biotin Conjugated | 0.1ml | 333 € | Bioss Primary Conjugated Antibodies | human |
| bs-7508R | THSD1 Antibody | 0.1ml | 263 € | Bioss Primary Unconjugated Antibodies | human |
| bs-7508R-Cy3 | THSD1 Antibody, Cy3 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-7508R-Cy5 | THSD1 Antibody, Cy5 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-7508R-Cy5.5 | THSD1 Antibody, Cy5.5 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-7508R-Cy7 | THSD1 Antibody, Cy7 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-7508R-FITC | THSD1 Antibody, FITC Conjugated | 0.1ml | 333 € | Bioss Primary Conjugated Antibodies | human |
| bs-7508R-HRP | THSD1 Antibody, HRP Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| GWB-754E0A | THSD1 Over-expression Lysate reagent | 1 tube | 562 € | genways | human |
| C846 | Recombinant Human Galectin-3, LGALS3 (C-6His, Human Cells) | 50 µg | 303 € | novo | human |
| CC79 | Recombinant Human GM-CSF, CSF2 (C-6His, Human Cells) | 10 µg | 146 € | novo | human |
| CD98 | Recombinant Human NGAL, Lipocalin-2, LCN2 (C-6His, Human Cells) | 500 µg | 1613 € | novo | human |
| CB01 | Recombinant Human SOD2, Mn-SOD (C-6His, Human Cells) | 500 µg | 1613 € | novo | human |
| C848 | Recombinant Human 15-PGDH, HPGD (C-6His) | 500 µg | 1613 € | novo | human |