Recombinant Human Poliovirus Receptor, PVR, CD155 (C-6His)

Contact us
Catalog number: C622
Price: 1929 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Poliovirus Receptor, PVR, CD155 (C-6His)
Quantity: 1000ug
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human 0 is produced by our Mammalian expression system and the target gene encoding Trp21-Asn343 is expressed with a 6His tag at the C-terminus
Molecular Weight: 13 kD, 36
UniProt number: P15151
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRNVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD155 (C-6His), PVR, Poliovirus Receptor
Short name: CD155 (C-6His), PVR, Recombinant Poliovirus Receptor
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD155 (C-6His), poliovirus receptor, sapiens Poliovirus Receptor, recombinant H
Alternative technique: rec
Alternative to gene target: CD155 and HVED and Necl-5 and NECL5 and PVS and TAGE4, Extracellular, PVR and IDBG-56486 and ENSG00000073008 and 5817, Pvr and IDBG-152745 and ENSMUSG00000040511 and 52118, cell adhesion molecule binding, this GO :0001618 and virus receptor activity and molecular function this GO :0002860 and positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target and biological process this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0009615 and response to virus and biological process this GO :0009986 and cell surface and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0016337 and single organismal cell-cell adhesion and biological process this GO :0016477 and cell migration and biological process this GO :0034329 and cell junction assembly and biological process this GO :0034332 and adherens junction organization and biological process this GO :0042271 and susceptibility to natural killer cell mediated cytotoxicity and biological process this GO :0045216 and cell-cell junction organization and biological process this GO :0045954 and positive regulation of natural killer cell mediated cytotoxicity and biological process this GO :0050776 and regulation of immune response and biological process this GO :0050839 and cell adhesion molecule binding and molecular function this GO :0060370 and susceptibility to T cell mediated cytotoxicity and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0001618 : virus receptor activity, this GO :0001618 : virus receptor activity and also this GO :0004872 : receptor activity and also this GO :0005515 : protein binding and also this GO :0050839 : cell adhesion molecule binding, this GO :0004872 : receptor activity, this GO :0005515 : protein binding, this GO :0050839 : cell adhesion molecule binding, poliovirus receptor
Identity: 9705
Gene: PVR | More about : PVR
Long gene name: poliovirus receptor
Synonyms gene: PVS
Synonyms: CD155 HVED Necl-5 NECL5 Tage4
Synonyms name: nectin-like 5
Locus: 19q13, 31
Discovery year: 2001-06-22
GenBank acession: BC015542
Entrez gene record: 5817
Pubmed identfication: 2170108
RefSeq identity: NM_006505
Classification: C2-set domain containing CD molecules V-set domain containing Immunoglobulin like domain containing
Havana BLAST/BLAT: OTTHUMG00000151527
Locus Specific Databases: ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database

Related Products :

C622 Recombinant Human Poliovirus Receptor, PVR, CD155 (C-6His) 1 mg 2283 € novo human
CS09 Recombinant Mouse Poliovirus Receptor, PVR, CD155 (C-6His) 10 µg 146 € novo mouse
PVR17-R-25 Recombinant (HEK) Human Poliovirus receptor (PVR or CD155 or Necl-5) protein (1-345aa, hIgG1-Fc-his, >95%) 25 μg 333 € adi human
PVR18-R-25 Recombinant (HEK) HUman Poliovirus receptor (PVR or CD155 or Necl-5) protein (1-345aa, his-tag, >95%) 25 μg 333 € adi human
PVR15-R-25 Recombinant (HEK) Mouse Poliovirus receptor (PVR or CD155 or Necl-5) protein (1-345aa, hIgG1-Fc-his, >95%) 25 μg 333 € adi mouse
PVR15-R-50 Recombinant (HEK) Mouse Poliovirus receptor (PVR or CD155 or Necl-5) protein (1-345aa, hIgG1-Fc-His, >95%) 50 μg 550 € adi mouse
PVR16-R-25 Recombinant (HEK) Mouse Poliovirus receptor (PVR or CD155 or Necl-5) protein (1-345aa, his-tag, >95%) 25 μg 333 € adi mouse
PVR16-R-50 Recombinant (HEK) Mouse Poliovirus receptor (PVR or CD155 or Necl-5) protein (1-345aa, His-tag, >95%) 50 μg 550 € adi mouse
RP-0269H Recombinant Human CD155 / PVR / NECL5 Protein 50μg 624 € adv human
RP-0268H Recombinant Human CD155 / PVR / NECL5 Protein (Fc Tag) 50μg 624 € adv human
RP-0267H Recombinant Human CD155 / PVR Protein (His Tag) 50μg 624 € adv human
RP-1094M Recombinant Mouse CD155 / PVR Protein (His & Fc Tag) 50μg 624 € adv mouse
RP-1095M Recombinant Mouse CD155 / PVR Protein (His Tag) 50μg 624 € adv mouse
RP-2037R Recombinant Rat CD155 / PVR / NECL5 Protein (His Tag) 20μg 572 € adv rat
RP-1145RC Recombinant Rhesus CD155 / PVR Protein (His Tag) 20μg 572 € adv rhesus
MBS241077 Anti-Human PVR / CD155 50ug 597 € MBS Polyclonals_1 human
AM26504AF-N anti-CD155 / PVR Antibody 0,1 mg 500 € acr human
AM26504FC-N anti-CD155 / PVR Antibody 0,1 ml 543 € acr human
AM26504RP-N anti-CD155 / PVR Antibody 50 Tests 572 € acr human
abx572760 Anti-Human Poliovirus Receptor (PVR) ELISA Kit inquire 50 € abbex human
AE24973HU-48 ELISA test for Human Poliovirus receptor (PVR) 1x plate of 48 wells 373 € abebio human
AE24973HU-96 Human Poliovirus receptor (PVR) ELISA Kit 1x plate of 96 wells 612 € abebio human
DL-PVR-Hu Human Poliovirus Receptor PVR ELISA Kit 96T 869 € DL elisas human
GWB-26E876 Poliovirus Receptor (PVR) Rabbit antibody to or anti-Human Polyclonal (aa403-417) antibody 1 x 1 vial 602 € genways human
GENTAUR-58bdd4d0ddc63 Anti- Poliovirus Receptor (PVR) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd6baa1c1e Anti- Poliovirus Receptor (PVR) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bddc9163e7d Anti- Poliovirus Receptor (PVR) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bddc91d7747 Anti- Poliovirus Receptor (PVR) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58b8bcca96818 Chlorocebus aethiops Poliovirus receptor homolog (PVR) 100ug 1929 € MBS Recombinant Proteins human
GENTAUR-58b8bccae8bbc Chlorocebus aethiops Poliovirus receptor homolog (PVR) 1000ug 1929 € MBS Recombinant Proteins human