| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human 0 is produced by our Mammalian expression system and the target gene encoding Trp21-Asn343 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
13 kD, 36 |
| UniProt number: |
P15151 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRNVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD155 (C-6His), PVR, Poliovirus Receptor |
| Short name: |
CD155 (C-6His), PVR, Recombinant Poliovirus Receptor |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD155 (C-6His), poliovirus receptor, sapiens Poliovirus Receptor, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD155 and HVED and Necl-5 and NECL5 and PVS and TAGE4, Extracellular, PVR and IDBG-56486 and ENSG00000073008 and 5817, Pvr and IDBG-152745 and ENSMUSG00000040511 and 52118, cell adhesion molecule binding, this GO :0001618 and virus receptor activity and molecular function this GO :0002860 and positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target and biological process this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0009615 and response to virus and biological process this GO :0009986 and cell surface and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0016337 and single organismal cell-cell adhesion and biological process this GO :0016477 and cell migration and biological process this GO :0034329 and cell junction assembly and biological process this GO :0034332 and adherens junction organization and biological process this GO :0042271 and susceptibility to natural killer cell mediated cytotoxicity and biological process this GO :0045216 and cell-cell junction organization and biological process this GO :0045954 and positive regulation of natural killer cell mediated cytotoxicity and biological process this GO :0050776 and regulation of immune response and biological process this GO :0050839 and cell adhesion molecule binding and molecular function this GO :0060370 and susceptibility to T cell mediated cytotoxicity and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0001618 : virus receptor activity, this GO :0001618 : virus receptor activity and also this GO :0004872 : receptor activity and also this GO :0005515 : protein binding and also this GO :0050839 : cell adhesion molecule binding, this GO :0004872 : receptor activity, this GO :0005515 : protein binding, this GO :0050839 : cell adhesion molecule binding, poliovirus receptor |
| Identity: |
9705 |
| Gene: |
PVR |
More about : PVR |
| Long gene name: |
poliovirus receptor |
| Synonyms gene: |
PVS |
| Synonyms: |
CD155 HVED Necl-5 NECL5 Tage4 |
| Synonyms name: |
nectin-like 5 |
| Locus: |
19q13, 31 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
BC015542 |
| Entrez gene record: |
5817 |
| Pubmed identfication: |
2170108 |
| RefSeq identity: |
NM_006505 |
| Classification: |
C2-set domain containing CD molecules V-set domain containing Immunoglobulin like domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000151527 |
| Locus Specific Databases: |
ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database |