| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human EDIL3/ is produced by our Mammalian expression system and the target gene encoding Val17-Glu480 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
09 kD, 53 |
| UniProt number: |
Q8N610 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
VPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEEVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
Del-1 (C-6His), EDIL3 |
| Short name: |
Del-1 (C-6His), Recombinant EDIL3 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
Del-1 (C-6His), sapiens epidermal growth factor-like repeats and discoidin I-like domains 3, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
DEL1, EDIL3 and IDBG-32547 and ENSG00000164176 and 10085, EDIL3 and IDBG-646527 and ENSBTAG00000044033 and 538062, Edil3 and IDBG-170705 and ENSMUSG00000034488 and 13612, multiple, protein binding, this GO :0005178 and integrin binding and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0007155 and cell adhesion and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0010811 and positive regulation of cell-substrate adhesion and biological process this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005178 : integrin binding, this GO :0005178 : integrin binding and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, EGF-like repeats and discoidin I-like domains 3 |
| Identity: |
3173 |
| Gene: |
EDIL3 |
More about : EDIL3 |
| Long gene name: |
EGF like repeats and discoidin domains 3 |
| Synonyms gene name: |
EGF-like repeats and discoidin I-like domains 3 |
| Synonyms: |
DEL1 |
| Locus: |
5q14, 3 |
| Discovery year: |
1999-12-16 |
| GenBank acession: |
U70312 |
| Entrez gene record: |
10085 |
| Pubmed identfication: |
9420328 |
| RefSeq identity: |
NM_005711 |
| Havana BLAST/BLAT: |
OTTHUMG00000119047 |