Recombinant Human EDIL3, Del-1 (C-6His)

Contact us
Catalog number: C601
Price: 717 €
Supplier: abbex
Product name: Recombinant Human EDIL3, Del-1 (C-6His)
Quantity: 30 nmol
Other quantities: 1 mg 2283€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human EDIL3/ is produced by our Mammalian expression system and the target gene encoding Val17-Glu480 is expressed with a 6His tag at the C-terminus
Molecular Weight: 09 kD, 53
UniProt number: Q8N610
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEEVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Del-1 (C-6His), EDIL3
Short name: Del-1 (C-6His), Recombinant EDIL3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: Del-1 (C-6His), sapiens epidermal growth factor-like repeats and discoidin I-like domains 3, recombinant H
Alternative technique: rec
Alternative to gene target: DEL1, EDIL3 and IDBG-32547 and ENSG00000164176 and 10085, EDIL3 and IDBG-646527 and ENSBTAG00000044033 and 538062, Edil3 and IDBG-170705 and ENSMUSG00000034488 and 13612, multiple, protein binding, this GO :0005178 and integrin binding and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0007155 and cell adhesion and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0010811 and positive regulation of cell-substrate adhesion and biological process this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005178 : integrin binding, this GO :0005178 : integrin binding and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, EGF-like repeats and discoidin I-like domains 3
Identity: 3173
Gene: EDIL3 | More about : EDIL3
Long gene name: EGF like repeats and discoidin domains 3
Synonyms gene name: EGF-like repeats and discoidin I-like domains 3
Synonyms: DEL1
Locus: 5q14, 3
Discovery year: 1999-12-16
GenBank acession: U70312
Entrez gene record: 10085
Pubmed identfication: 9420328
RefSeq identity: NM_005711
Havana BLAST/BLAT: OTTHUMG00000119047

Related Products :

C601 Recombinant Human EDIL3, Del-1 (C-6His) 1 mg 2283 € novo human
B6024-25 DEL-22379 25mg 25mg 682 € Ape human
B6024-5 DEL-22379 5mg 5mg 227 € Ape human
abx151378 Anti-Human EDIL3 ELISA Kit inquire 50 € abbex human
abx573117 Anti-Human EDIL3 ELISA Kit inquire 50 € abbex human
LV145071 EDIL3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV145072 EDIL3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV145073 EDIL3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV145074 EDIL3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV145076 EDIL3 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV145075 EDIL3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58b884a7ec1de Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) 100ug 2277 € MBS Recombinant Proteins human
GENTAUR-58b884a83b185 Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) 1000ug 2277 € MBS Recombinant Proteins human
GENTAUR-58b884a88c59a Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) 100ug 2790 € MBS Recombinant Proteins human
GENTAUR-58b884a8cd3a9 Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) 1000ug 2790 € MBS Recombinant Proteins human
DL-EDIL3-Hu Human EGF Like Repeats And Discoidin I Like Domains Protein 3 EDIL3 ELISA Kit 96T 974 € DL elisas human
DEL-101AP anti-EDIL3 Antibody 100 µg 357 € fabgen human
GENTAUR-58bded72e1f02 Anti- EDIL3 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bded734cea6 Anti- EDIL3 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf43f45fc3 Anti- EDIL3 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf43fa796b Anti- EDIL3 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf7bfbcd19 Anti- EDIL3 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf7c0380be Anti- EDIL3 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be426a0f60f Anti- EDIL3 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be5085235e8 Anti- EDIL3 Antibody 0.2 mg 663 € MBS Polyclonals human
GENTAUR-58be50857fe26 Anti- EDIL3 Antibody 50ug 365 € MBS Polyclonals human
DEL-BIOTIN anti-EDIL3 BIOTIN 100 µg 456 € fabgen human
DEL-FITC anti-EDIL3 FITC 100 µg 456 € fabgen human
abx914956 Anti-EDIL3 siRNA 30 nmol 717 € abbex human
abx914957 Anti-EDIL3 siRNA 30 nmol 717 € abbex human