Recombinant Human Butyrophilin Subfamily 3 Member A1, BTN3A1, CD277 (C-Fc)

Catalog number:	C564 Buy Now
Price:	630 €
Supplier:	MBS mono
Product name:	Recombinant Human Butyrophilin Subfamily 3 Member A1, BTN3A1, CD277 (C-Fc)
Quantity:	100ug
Other quantities:	10 µg 126€ 50 µg 278€ 500 µg 963€
Related search:	human gene sapiens culture cfc

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Butyrophilin Subfamily 3 Member A1 is produced by our Mammalian expression system and the target gene encoding Gln30-Gly254 is expressed with a Fc tag at the C-terminus
Molecular Weight:	50, 8 kD
UniProt number:	O00481
State of the product:	Freeze-dried
Shipping conditions:	Ambient temperature
Formulation:	pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations:	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution:	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	BTN3A1, CD277 (C-Fc), Butyrophilin Subfamily 3 Member A1
Short name:	BTN3A1, CD277 (C-Fc), Recombinant Butyrophilin Subfamily 3 Member A1
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	BTN3A1, CD277 (C-fragment c), sapiens Butyrophilin Subfamily 3 Member A1, recombinant H
Alternative technique:	rec
Identity:	1138
Gene:	BTN3A1 | More about : BTN3A1
Long gene name:	butyrophilin subfamily 3 member A1
Synonyms gene name:	butyrophilin, member A1 , subfamily 3
Synonyms:	BT3, 1 , 1 BTF5 CD277 BTN3
Locus:	6p22, 2
Discovery year:	1999-08-27
GenBank acession:	U90552
Entrez gene record:	11119
Pubmed identfication:	9149941
Classification:	C2-set domain containing CD molecules V-set domain containing Butyrophilins
Havana BLAST/BLAT:	OTTHUMG00000014449

• #human
• #gene
• #sapiens
• #culture
• #cfc