| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Regenerating Islet-Derived Protein 1-alpha is produced by our Mammalian expression system and the target gene encoding Gln23-Asn166 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
17, 31 kD |
| UniProt number: |
P05451 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKNVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
REG1A (C-6His), Regenerating Islet-Derived Protein 1-&alpha |
| Short name: |
REG1A (C-6His), Recombinant Regenerating Islet-Derived Protein 1-&alpha |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
REG1A (C-6His), sapiens Regenerating Islet-Derived Protein 1-&alpha, recombinant H |
| Alternative technique: |
rec |
| Identity: |
9951 |
| Gene: |
REG1A |
More about : REG1A |
| Long gene name: |
regenerating family member 1 alpha |
| Synonyms gene: |
REG |
| Synonyms gene name: |
pancreatic thread protein) , regenerating islet-derived 1 alpha (pancreatic stone protein |
| Synonyms: |
PSP PTP PSPS PSPS1 |
| Synonyms name: |
pancreatic stone protein pancreatic thread protein |
| Locus: |
2p12 |
| Discovery year: |
1992-06-05 |
| Entrez gene record: |
5967 |
| Pubmed identfication: |
2332435 8333731 |
| RefSeq identity: |
NM_002909 |
| Classification: |
C-type lectin domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000130016 |